Dbfetch

LOCUS       NM_001269630            3312 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Serine/threonine-protein kinase par-1
            (par-1), partial mRNA.
ACCESSION   NM_001269630
VERSION     NM_001269630.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 3312)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 3312)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 3312)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 3312)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003283).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..3312
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="V"
     gene            <1..>3312
                     /gene="par-1"
                     /locus_tag="CELE_H39E23.1"
                     /db_xref="GeneID:179912"
                     /db_xref="WormBase:WBGene00003916"
     CDS             1..3312
                     /gene="par-1"
                     /locus_tag="CELE_H39E23.1"
                     /standard_name="H39E23.1f"
                     /note="Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Serine/threonine-protein kinase par-1"
                     /protein_id="NP_001256559.1"
                     /db_xref="GeneID:179912"
                     /db_xref="WormBase:WBGene00003916"
                     /translation="MNGTSTATATGGGGTSGATTTASSGAPAASSGGSSARYSSSGRS
                     HPTSGSSSSHARSTGQSGMSSRSAARRNDQDVHVGKYKLLKTIGKGNFAKVKLAKHVI
                     TGHEVAIKIIDKTALNPSSLQKLFREVKIMKQLDHPNIVKLYQVMETEQTLYLVLEYA
                     SGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYLHSKNIIHRDLKAENLLLDQDMNIK
                     IADFGFSNTFSLGNKLDTFCGSPPYAAPELFSGKKYDGPEVDVWSLGVILYTLVSGSL
                     PFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLVINPQRRSSLDNIMKDRWMNV
                     GYEDDELKPFIEPPKDQIDEQRIEKLIQIFQLGFNKAAILESVEKEKFEDIHATYLLL
                     GERKSDMDASEITMAQSLLSHSSINVSSSLGQHPAGVITREHVTSSSASGSSASPSRY
                     SRSSATATGASITAGSALASAANAQKHQQSSAAPSSGSSSSRRSSQNDAAATAAGGTV
                     VMSGTRHGGVQMRAQPTSRQATISLLQPPSYKPSSNTTQIAQIPPLFNRNSTATSSAA
                     QPSTGITGTRKIADPKGRIPLNSTAVQGHRTATGAVAANNGGIPSHRDHAQQQQYMNQ
                     LTSSTMMSKLINKTPAAGGTAATSSSSSSSATSTAPLQKSGSQISHAPTEPVIREDDD
                     ENNSENQNGNVPLIGGVGPQTSPAVQVPTEDATSSSDKEQQQQKASSETPKESKPSMI
                     HQSPSMPPSQMMTAMESLKLSESGQTGGPTVATGGPPQRATSQQMSRSATTNSANMGA
                     SSGGAAAAASATNQLSGAPSSTGASSQQYHPKAPSSSSSSSTNPPHQHQLTHNASFSV
                     TPSSYQIPTSTAVNVTSTGMPTSSSSSAFPRNTRNRQTFHGKTEKDKGGDDSSDEIGE
                     TPGNVSIGATGPSANNAEATIWSKLSKLTRRDHNRESMTQPVSGRAGTIGASQGQQTA
                     AALAAIREQSGPIAPGAGQVAPSLPIHEGDVKPRSLRFTWSMKTTSSLAPDDMMREIR
                     KVLDANGCDYEQRERYMILCVHGDPNTDSLVQWEMEVCKLPRLSLNGVRFKRISGTSI
                     GFKNIASKIAQELNL"
ORIGIN      
        1 atgaacggaa cgtcgacggc aactgccacc ggtggcggag gaacatctgg agccaccaca
       61 acggcatcat caggagcacc ggctgcttca tcgggtggaa gctcggctag atattcgagt
      121 agtgggagat cccatccaac gtctggaagc tcttcatcac atgcacgatc tactggacaa
      181 tcgggtatgt caagtcgatc ggcagcacga cgcaacgatc aggatgtaca cgttggaaag
      241 tataagctat tgaagactat tggaaaggga aattttgcaa aggtaaaact cgcaaagcac
      301 gtgataaccg gacatgaagt cgctataaaa attatcgaca agactgctct gaacccatcg
      361 agtcttcaaa aattgttccg agaagtgaaa attatgaaac aattggatca tccgaatatt
      421 gtgaaattat atcaagtgat ggaaactgaa cagacactgt atttagtact cgaatatgca
      481 tccggtggtg aagtatttga ttatttggtt gcacacggaa gaatgaaaga gaaagaagca
      541 agagccaaat ttcgacaaat tgtctctgct gttcaatatt tgcattcgaa aaatataatt
      601 catcgagatt tgaaagctga aaatttgctt ctcgatcaag atatgaatat taaaattgct
      661 gattttggat tttcgaatac cttctcactt ggaaacaaac tcgacacatt ttgtggatct
      721 ccaccgtacg ctgctccaga attattttcc ggtaaaaagt acgatggtcc tgaagtagat
      781 gtttggagtc ttggtgtaat tctctatact cttgtatccg gaagtctacc atttgatgga
      841 caaaatttga aagagcttcg agaacgtgtg ctccgtggaa aataccgtat cccgttctat
      901 atgtcaacgg attgtgagaa tttgttgaag aaattccttg ttatcaatcc acaaaggaga
      961 tcatcattgg ataatattat gaaagatcga tggatgaatg tgggatatga agatgatgag
     1021 cttaagccat ttattgagcc accaaaagat caaattgatg aacagagaat tgagaaattg
     1081 attcagatct tccaactcgg attcaacaaa gccgccattt tggaaagcgt cgagaaggaa
     1141 aagtttgaag atattcatgc aacgtatttg cttttaggag aacgaaaatc tgatatggat
     1201 gccagtgaaa tcacaatggc ccaatcactg ctcagccatt cgtcaatcaa tgtttcgtcg
     1261 tctctgggtc agcacccggc cggtgttatc actagggagc atgtgacgtc atcatcagcg
     1321 tctggaagct ctgcttcacc atcccgatac tctcgatcct cagcaacagc cacaggtgca
     1381 tcaatcactg caggatcagc gctcgcatcg gctgcgaatg ctcagaaaca tcagcaatca
     1441 tcggcagctc catcgtcagg atcttcgtcg tcgaggagaa gctcgcaaaa cgatgcggca
     1501 gcgacggcgg ctggtggtac tgtagtgatg agtggaacaa ggcatggtgg agttcagatg
     1561 agagctcagc cgacgagtcg gcaagcgaca atcagtttat tgcaaccgcc gagttataag
     1621 ccttcctcca acaccacgca aattgctcaa attccgccac tattcaatag aaactcaacg
     1681 gcaacctcat cagctgctca accttcaaca ggaatcaccg gtactcgaaa gattgctgat
     1741 ccaaaaggac gaattccgct caattcgact gctgtacaag gacatcgaac tgcaacaggt
     1801 gcagttgcag ccaataatgg tggtattcca agtcatcggg atcatgctca gcagcagcag
     1861 tatatgaatc aactcacctc gtcgacaatg atgtcaaagc tcatcaataa gactccagcg
     1921 gctggtggta ctgcagccac gtcatcttct tcctcatcgt ctgccacgtc gacagcgcca
     1981 cttcagaaat ctggatcaca aatctcgcac gcaccgactg aaccagtcat tcgagaagac
     2041 gacgacgaga ataacagtga gaatcagaat ggaaatgttc cattgatcgg aggtgtcgga
     2101 ccacaaacct ctccagctgt tcaagtacca acagaagatg caacttcatc atcagacaag
     2161 gaacaacagc agcagaaagc atccagtgag acacccaaag agtccaagcc gtcgatgatc
     2221 caccaatctc catcaatgcc tccatcacag atgatgactg cgatggaatc attgaaattg
     2281 agcgagagtg gtcaaacggg gggaccgaca gtggcgacgg gaggtccacc acaacgagcc
     2341 acatcacagc aaatgtctcg ttcggcaaca accaatagtg caaatatggg tgcatcatca
     2401 ggaggtgctg ctgctgctgc ttctgccaca aatcaattat cgggtgctcc ttcttctacg
     2461 ggtgcttcta gtcagcaata tcatccaaaa gctccatcat catcttcatc ttcatctaca
     2521 aatccaccac atcaacatca actaacacat aacgcgtcgt tctcggtgac accatcatca
     2581 tatcaaattc caacatcaac agctgtgaac gttacctcca ctggaatgcc aacatcatca
     2641 tcttcatcag ctttccctag aaatactcgt aatcgacaga ctttccatgg aaaaacggag
     2701 aaggacaagg gaggcgacga cagttctgat gaaattggag aaactccggg caatgtttca
     2761 attggagcaa ctggtccatc ggccaacaat gcagaagcaa caatctggag caaattgagc
     2821 aaattgacga gacgagatca taatcgagaa agtatgaccc agccagtatc aggacgtgct
     2881 ggaaccatcg gagcatcaca aggacagcaa accgcggcgg ctcttgctgc gattcgggaa
     2941 cagtctggcc caattgctcc aggtgccgga caagttgcac catcgcttcc gattcatgaa
     3001 ggagacgtca agccacgatc attgcggttc acgtggagta tgaagacgac ttcttcattg
     3061 gctccggatg atatgatgag agaaattcga aaagttcttg acgctaacgg ttgtgactac
     3121 gagcaacggg aacgatacat gattctgtgt gtgcacggtg atccgaatac agactcactt
     3181 gttcaatggg agatggaggt ctgcaagttg ccacgtctca gtctgaatgg agttcgattc
     3241 aaacgaatct cgggaacatc gattggcttc aagaatatcg cttcgaaaat agcccaagag
     3301 ctgaaccttt ag
//