Dbfetch

LOCUS       NM_001268248            4341 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Prion-like-(Q/N-rich)-domain-bearing protein
            (pqn-80), partial mRNA.
ACCESSION   NM_001268248
VERSION     NM_001268248.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 4341)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 4341)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 4341)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 4341)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003281).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..4341
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="III"
     gene            <1..>4341
                     /gene="pqn-80"
                     /locus_tag="CELE_Y111B2A.14"
                     /db_xref="GeneID:176683"
                     /db_xref="WormBase:WBGene00004161"
     CDS             1..4341
                     /gene="pqn-80"
                     /locus_tag="CELE_Y111B2A.14"
                     /standard_name="Y111B2A.14b"
                     /note="Product from WormBase gene class pqn;
                     Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Prion-like-(Q/N-rich)-domain-bearing protein"
                     /protein_id="NP_001255177.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00004161"
                     /db_xref="EnsemblGenomes-Tr:Y111B2A.14b.1"
                     /db_xref="EnsemblGenomes-Tr:Y111B2A.14b.2"
                     /db_xref="GeneID:176683"
                     /db_xref="InterPro:IPR014840"
                     /db_xref="UniProtKB/TrEMBL:C7IVS6"
                     /db_xref="WormBase:WBGene00004161"
                     /translation="MDSLGSSKKKKKAEKSAKNEVIQIRISVAKPGSKKYTHVDWEEL
                     LKNNGKERDEDDLRRFYDEDTLFMAKKLGETRSKSGKKLRVNLDQLQHFNRKCGYDMD
                     DDFIDDTEIVDDEPTTSKKGGFYVGKGDVKDSNDEDEEEEEETDVEESIQEVPKKVKI
                     RKIKEKSGEKSSKSSDSSSSSSSDSEDAAGPPRMTGAPPSIRMVSSSSSLKKLPAPRK
                     PSPPPAVEPTRSVEIIEKPEKTEKPAEKRKTAATTSALEPAEKKKKPDSSSSSEEIIL
                     IDDNAPAAKKQPESAQKGSTTVTMSAKKICKQQEEIAKQKPSSSSVTPSKPAAPTAST
                     PKKEEIGTLETFLKNIFANLDAKGKLYQEKKLKTFDTETLKEITTFIDVMKHHKTEKV
                     NMEPLIYSLAKSFGMTTQEVMKQVEQEISSKKATTPKPSTNAVLSTISSQKSLEKNAA
                     DWKLTQTDLPTMGEKDIQMLTTIVRSWKSKKEISNSMVTGWLKDVNQLKMNADQARKK
                     FFDIINTLPDSSEKNGGGGQQDANDIPKHERSRKARMFLHQWVYLSRKFLELQLPKLK
                     HHSPPVEGLAKKQVIAANAIKEGVRKQISLFENKKDRLPGDPVYVFQFTEPVLTAVAP
                     YLEDLVDYALAAKKIELIVSGIDALHQSTDGKITIIQFYIEICRRLQKLSFLAVEEPM
                     KSRLKEANEQIMKHQVVQIPKYQLKWPDGQAEPSLKGLNRELYEFDKSILSMVAAKPS
                     APATPKASSSTALRPSTSSTPSQQQSTSTAKAMTSSSTSAEDAKRLLAMNQLVQVYAG
                     KYLLPTGNSTADICDPTICLMNDDILLIMVTAVYSCGIPLVNQMNMLKNVLCQVGQTR
                     MAQTLATQKTQNKQCLTQNDYQLLFDYFGKFEKALEQRKAKKEEAERLKKLEEKLKKE
                     KEKQAEKDRIEAKKFEERMKKEQEKQEEKERKEREKREEKERKEREIREIMERKKREE
                     DDRIAAKLQIAQQLENDRKMREAEESARKETERRAKMETEAANALQGLEEDLLMDDID
                     FMTQQQTKVDEERKVAEARRAVERENQIKMMRAQQLQRRQEEAPPPQQAPAPHTQKIQ
                     VKNEPVDHSFDILKEAEKDAHIIPTKSIKAEPLDVQKPLSAFEKLASLRGRTQSADMR
                     RGGDSTEMPNVTQQYQAEQNHLAQSSNNSQYNAPSTSSQPQHFPTEPSIRQPPPQQSY
                     NSNQMLQNPRQQPQNQIVQNFQSAPQRHPHQNPQIATSSSSGGVNQFYNNGGAAPPVV
                     EQQAANRRSSFTMSHSVQQHQSPLQQQFPINSYQSPSHHNNSSSMSNSSLMQTPHSNS
                     SMIARSPQFPSHTSPMSQRFHTPPSVGHQMVQSPLSQPNPSPLQHFNFSPHSSSFSSQ
                     RPQMPPQRQMSQQNLMHQQQQPQNHTQHQYQHQTFSSQQQQLQQHQHQIRHQMNTNYP
                     PPPGYNHHGH"
ORIGIN      
        1 atggactcat tgggtagctc aaagaagaag aaaaaagccg aaaagagcgc gaaaaacgag
       61 gttattcaaa ttcgcatcag tgtcgcgaag ccgggcagca agaaatacac tcatgtcgat
      121 tgggaggaac tgctgaagaa taatggaaaa gagcgggacg aagatgatct ccgcagattt
      181 tacgatgaag acacactttt tatggcaaaa aagctcgggg agacgagaag caaaagtgga
      241 aagaaacttc gcgttaattt ggaccagctg caacatttca accgaaagtg tggatatgat
      301 atggatgatg actttattga tgacacagaa atagttgacg acgagcctac aacatcgaaa
      361 aagggtggat tttatgtggg aaagggtgat gtgaaggatt caaacgacga ggatgaggaa
      421 gaagaagaag aaaccgatgt ggaagaatcg attcaggaag ttccgaagaa ggtgaaaatc
      481 aggaaaatca aagagaaatc tggcgaaaaa tccagtaaat ccagtgattc ttcatcatcc
      541 tcctcgtccg attcggagga tgctgctggg cctccgagaa tgacaggagc tccaccgtca
      601 attcgaatgg tttcttcttc ttcttctttg aagaagcttc cggcccctcg aaaaccatcc
      661 ccgccgccgg ctgtagagcc cacaagatct gtggaaatta ttgagaagcc tgaaaagact
      721 gaaaagcccg ccgaaaagcg aaaaaccgcg gccaccacat ccgcactgga gcctgctgaa
      781 aagaagaaaa agccggatag tagtagtagt tcggaggaga taattcttat tgatgataat
      841 gctccggctg caaagaagca gccggaaagt gctcaaaaag ggtccaccac agtcaccatg
      901 tcagccaaga aaatctgcaa acaacaggaa gaaatcgcta agcagaagcc gtcatcatca
      961 tctgtaactc catcaaaacc agctgctcca acagcttcaa caccgaaaaa agaggaaatc
     1021 gggactcttg agacgttcct gaagaatata tttgcaaatt tagatgcaaa agggaaactt
     1081 tatcaggaga aaaagttgaa aactttcgat acggagactt taaaggagat aacaacgttt
     1141 atagatgtaa tgaagcatca taaaactgaa aaagttaata tggaaccgtt gatttattcg
     1201 ttggcgaaat catttggaat gactacgcaa gaagttatga aacaggtcga acaagaaatt
     1261 tcgtcgaaaa aggcaacaac tccaaaacct tcaacaaatg cagttttatc gacaatttca
     1321 tctcaaaaat cattggaaaa aaatgcagcc gattggaaat taacacaaac ggatttaccc
     1381 acaatgggag aaaaagatat acaaatgttg acgacaattg ttcgatcatg gaaaagtaaa
     1441 aaagaaatat cgaattcaat ggtgactgga tggctgaaag atgtgaatca attgaaaatg
     1501 aacgcagatc aagcgaggaa aaaattcttc gacatcataa atactttgcc ggattcgtct
     1561 gaaaaaaatg gtggtggtgg acagcaagat gccaacgata ttccaaaaca cgaacgatca
     1621 cgtaaagctc gaatgtttct ccaccaatgg gtctatttat ctcgtaaatt tttggagctt
     1681 caacttccaa aattgaaaca tcattctcca cctgtcgaag gtctcgcaaa gaagcaagtt
     1741 atcgctgcaa atgcaataaa agaaggtgtt aggaagcaaa tttcactttt tgaaaataag
     1801 aaagatcgtc tgcccggtga tcctgtctac gtattccagt ttacggagcc tgttttaacc
     1861 gcagtcgccc catacttgga agatctcgtc gattatgcgc tcgcggcgaa aaaaatcgag
     1921 ttaattgtat ccggaatcga cgctctacac caatcaactg acggaaaaat taccataatt
     1981 caattttata ttgaaatctg ccgaagactt cagaaattat catttctcgc cgttgaagaa
     2041 ccaatgaaaa gtcgtctgaa agaagcaaat gaacaaatta tgaagcatca agttgttcaa
     2101 attccaaaat atcaattgaa atggcctgat ggacaggcgg agccatctct gaaagggctt
     2161 aatcgagagc tttatgaatt cgacaaatca attctctcca tggtggcggc taaaccatca
     2221 gctcctgcaa ctccaaaagc ttcatcatct acagccctcc gcccttctac gtcatcaact
     2281 ccatctcagc agcaatccac gtcaactgca aaagctatga cgtcatcatc aacatcagca
     2341 gaagatgcga agcgcttact cgcaatgaat caacttgttc aggtttacgc gggaaaatat
     2401 ctgctcccga ccggcaattc aacggcagac atttgtgatc caacaatttg tctaatgaat
     2461 gatgatattc tactgattat ggtaacagct gtctattcgt gtggtatacc attggttaat
     2521 caaatgaata tgcttaaaaa tgtcctatgc caagttggtc aaacccgaat ggctcagaca
     2581 ttggcaacac aaaaaactca aaataagcag tgcctgaccc aaaatgacta tcaactactt
     2641 tttgattatt ttggaaagtt tgaaaaagca ttagaacaac gaaaagcaaa aaaagaagaa
     2701 gctgaaagat tgaagaaatt ggaggaaaaa ttgaaaaaag agaaggagaa acaagcagag
     2761 aaagatagaa ttgaggcgaa gaaattcgaa gagcggatga aaaaagagca agaaaaacag
     2821 gaagaaaaag agagaaaaga acgggaaaaa cgagaggaaa aggaaaggaa agagagagaa
     2881 attcgagaaa ttatggagag gaaaaagaga gaagaagacg atcgaattgc tgcgaaatta
     2941 caaattgctc aacaattaga gaatgacagg aaaatgagag aagctgaaga aagtgcacgg
     3001 aaggagacgg aacggagggc taaaatggaa actgaagcag caaatgcact acaaggactc
     3061 gaagaggacc ttctcatgga tgatatcgat tttatgactc aacaacaaac aaaagtcgat
     3121 gaggaacgaa aagtggcgga agctcggcga gcagttgaac gtgagaatca gatcaaaatg
     3181 atgagggctc aacagctgca aagacggcag gaagaggctc cgccccctca acaagctcca
     3241 gctccacata cacaaaagat tcaagtgaaa aatgagccag tagatcattc attcgatatt
     3301 ctaaaagaag cagaaaaaga tgcacacata attccaacaa aatcaataaa agccgagccg
     3361 ctggacgttc aaaaaccgct tagcgcattt gaaaagcttg catcacttcg tggtaggacc
     3421 caatctgctg atatgagaag aggcggggac tctacggaaa tgccgaatgt gacacaacaa
     3481 tatcaagcgg agcaaaatca tctagcacaa agttcgaata attctcagta caatgcacca
     3541 agtacaagtt cccagccaca acatttccca acagagcctt caatacgcca accacctccc
     3601 caacagagtt acaattccaa ccaaatgctc caaaatccac gacagcaacc ccaaaaccaa
     3661 attgtgcaaa atttccaaag tgctccgcaa cgacatcccc atcaaaatcc gcaaattgcc
     3721 acgtcatctt catctggagg agtcaatcag ttttataata atggtggagc tgcaccgcca
     3781 gttgtcgaac aacaagccgc taatagaaga tcatcattca caatgtctca ttcagttcaa
     3841 caacaccaat ctcctctcca acaacaattt ccaatcaatt catatcaatc accgagtcat
     3901 cataataata gtagctcaat gagcaattcc tcattaatgc aaacaccaca cagtaatagt
     3961 tcaatgattg cacggagtcc acaatttcca tctcatacgt ccccaatgtc ccaacgattc
     4021 cataccccac catcagttgg gcatcaaatg gtgcagagcc cattgtctca accgaatcct
     4081 tcgcctcttc aacatttcaa cttttcgcca cattcctcca gtttttcatc acaaagacct
     4141 caaatgccgc cacaacgtca aatgagccaa caaaatctca tgcatcaaca gcaacaacca
     4201 caaaatcata ctcaacatca gtaccaacat cagacattca gttctcagca acaacagctt
     4261 caacaacatc aacaccaaat ccggcaccaa atgaatacca actacccacc gccaccaggc
     4321 tacaatcatc atggccatta a
//