Dbfetch

LOCUS       NM_001267971            1065 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans SUPpressor (sup-26), partial mRNA.
ACCESSION   NM_001267971
VERSION     NM_001267971.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 1065)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 1065)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1065)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 1065)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003281).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1065
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="III"
     gene            <1..>1065
                     /gene="sup-26"
                     /locus_tag="CELE_R10E4.2"
                     /db_xref="GeneID:175551"
                     /db_xref="WormBase:WBGene00006331"
     CDS             1..1065
                     /gene="sup-26"
                     /locus_tag="CELE_R10E4.2"
                     /standard_name="R10E4.2f"
                     /note="Product from WormBase gene class sup;
                     Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="SUPpressor"
                     /protein_id="NP_001254900.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00006331"
                     /db_xref="EnsemblGenomes-Tr:R10E4.2f.1"
                     /db_xref="EnsemblGenomes-Tr:R10E4.2f.2"
                     /db_xref="EnsemblGenomes-Tr:R10E4.2f.3"
                     /db_xref="EnsemblGenomes-Tr:R10E4.2f.4"
                     /db_xref="GeneID:175551"
                     /db_xref="GOA:D5MCQ1"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="UniProtKB/TrEMBL:D5MCQ1"
                     /db_xref="WormBase:WBGene00006331"
                     /translation="MNASSAPQQQQQQQQPQQGQAPQQQQQGPPQHQYQQQRPFHGRV
                     QNHMRGSGPFGNSNGYGRYTAPRGDQQHHDSTPLSSTNLYIRGLMPNTNDDLLREMCS
                     KYGNIASTKAIMDKATNNCKGYGFVDFESPQAAAAAVDGLNTEGVQAQMAKLQQQEQD
                     PTNLYIANLPLDFTEQMLETELNKFGMVISTRILRTPDNQSRGVGFARMDSKEKCEVI
                     ISALNGGRFDTMSKEGPALLIKQADTGRKSKHSMNNPEMLQRMQYPQVYQSYYGYHPA
                     AVYQQHYDVNSLASQMGGMHVGGGNPQANGGGDMYGAHMYGQNAGGQGGQGVGQGGQG
                     GNQQFYNPNNGRNKKPMNPQ"
ORIGIN      
        1 atgaacgcat cttcggctcc acaacaacaa cagcaacaac agcagccaca acaagggcaa
       61 gctccccagc aacaacaaca gggaccacca caacatcaat atcaacaaca acgcccattc
      121 catggacgtg tccaaaacca tatgagagga agcggaccgt ttggaaacag caacggctat
      181 ggtcgttaca cagctccacg tggtgaccag cagcatcacg actcgactcc tttgagctcg
      241 actaatctct acattcgcgg tctcatgcca aacaccaacg atgatctcct tcgtgaaatg
      301 tgctccaagt acggaaacat tgcatcgacc aaagctatta tggataaagc aaccaacaat
      361 tgcaagggat acggatttgt tgactttgaa tctccacaag ccgctgctgc agcagttgac
      421 gggctcaaca ctgaaggagt tcaagcacaa atggcaaagc ttcaacaaca agagcaagat
      481 ccaaccaact tgtacattgc caacttgcca ttggacttca ccgaacaaat gctcgagact
      541 gagctcaaca agtttggaat ggtgatctct acacgtattc ttcgtactcc agacaatcag
      601 tcgcgtggag tcggattcgc cagaatggat tcgaaggaaa agtgcgaagt tatcatttct
      661 gcgttgaatg gtggtcgctt cgatactatg tcaaaggaag gtccagccct gctcattaag
      721 caagccgata ccggcaggaa gagtaagcac tcgatgaaca atcctgaaat gctccagcga
      781 atgcaatatc cacaagtcta tcaatcgtac tatggatacc atccagctgc agtctaccaa
      841 caacactatg acgttaactc gttggcttca cagatgggcg gtatgcatgt cggtggtgga
      901 aatccacagg cgaatggtgg aggtgacatg tatggagcac atatgtacgg acagaatgcc
      961 ggtggacaag gtggacaagg agtcggacaa ggcggacagg gtgggaatca acagttttac
     1021 aacccgaata atggacgcaa caaaaagccg atgaatccac aataa
//