Dbfetch

LOCUS       NM_001267967            1317 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans SUPpressor (sup-26), partial mRNA.
ACCESSION   NM_001267967
VERSION     NM_001267967.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 1317)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 1317)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1317)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 1317)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003281).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1317
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="III"
     gene            <1..>1317
                     /gene="sup-26"
                     /locus_tag="CELE_R10E4.2"
                     /db_xref="GeneID:175551"
                     /db_xref="WormBase:WBGene00006331"
     CDS             1..1317
                     /gene="sup-26"
                     /locus_tag="CELE_R10E4.2"
                     /standard_name="R10E4.2m"
                     /note="Product from WormBase gene class sup;
                     Confirmed by transcript evidence"
                     /codon_start=1
                     /product="SUPpressor"
                     /protein_id="NP_001254896.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00006331"
                     /db_xref="EnsemblGenomes-Tr:R10E4.2m.1"
                     /db_xref="EnsemblGenomes-Tr:R10E4.2m.2"
                     /db_xref="GeneID:175551"
                     /db_xref="GOA:D5MCQ6"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="UniProtKB/TrEMBL:D5MCQ6"
                     /db_xref="WormBase:WBGene00006331"
                     /translation="MNASSAPQQQQQQQQPQQGQAPQQQQQGPPQHQYQQQRPFHGRV
                     QNHMRGSGPFGNSNGYGRYTAPRGDQQHHDSTPLSSVSSRRVPLPPTSQHRASSNFNT
                     TPSSTNLYIRGLMPNTNDDLLREMCSKYGNIASTKAIMDKATNNCKGYGFVDFESPQA
                     AAAAVDGLNTEGVQAQMAKLQQQEQDPTNLYIANLPLDFTEQMLETELNKFGMVISTR
                     ILRTPDNQSRGVGFARMDSKEKCEVIISALNGGRFDTMSKEGPALLIKQADTGRKSKH
                     SMNNPEMLQRMQYPQVYQSYYGYHPAAVYQQHYDVNSLASQMGGMHVGGGNPQANGGG
                     DMYGAHMYGQNAGGQGGQGVGQGGQVFPADESTINGQDNVFTPLLLSSLNLFSLSILS
                     NQSSLQKKTQCAAARAAINTHVHIVSPLPDPQNLLLFLNPKTIVPF"
ORIGIN      
        1 atgaacgcat cttcggctcc acaacaacaa cagcaacaac agcagccaca acaagggcaa
       61 gctccccagc aacaacaaca gggaccacca caacatcaat atcaacaaca acgcccattc
      121 catggacgtg tccaaaacca tatgagagga agcggaccgt ttggaaacag caacggctat
      181 ggtcgttaca cagctccacg tggtgaccag cagcatcacg actcgactcc tttgagctcg
      241 gtgagttcgc gtcgagttcc tcttccaccc acttcacagc atcgtgcctc atccaatttc
      301 aacactactc ccagttctac taatctctac attcgcggtc tcatgccaaa caccaacgat
      361 gatctccttc gtgaaatgtg ctccaagtac ggaaacattg catcgaccaa agctattatg
      421 gataaagcaa ccaacaattg caagggatac ggatttgttg actttgaatc tccacaagcc
      481 gctgctgcag cagttgacgg gctcaacact gaaggagttc aagcacaaat ggcaaagctt
      541 caacaacaag agcaagatcc aaccaacttg tacattgcca acttgccatt ggacttcacc
      601 gaacaaatgc tcgagactga gctcaacaag tttggaatgg tgatctctac acgtattctt
      661 cgtactccag acaatcagtc gcgtggagtc ggattcgcca gaatggattc gaaggaaaag
      721 tgcgaagtta tcatttctgc gttgaatggt ggtcgcttcg atactatgtc aaaggaaggt
      781 ccagccctgc tcattaagca agccgatacc ggcaggaaga gtaagcactc gatgaacaat
      841 cctgaaatgc tccagcgaat gcaatatcca caagtctatc aatcgtacta tggataccat
      901 ccagctgcag tctaccaaca acactatgac gttaactcgt tggcttcaca gatgggcggt
      961 atgcatgtcg gtggtggaaa tccacaggcg aatggtggag gtgacatgta tggagcacat
     1021 atgtacggac agaatgccgg tggacaaggt ggacaaggag tcggacaagg cggacaggta
     1081 tttccagccg atgaatccac aataaatgga caggacaacg tcttcactcc acttcttctt
     1141 tcgtctctaa acctcttctc tctctcaatc ctttccaacc aatcatctct acaaaaaaag
     1201 acacagtgtg ctgccgcgcg cgccgcaatc aatacccatg ttcatattgt tagcccgctc
     1261 cccgatccac aaaaccttct tctttttctc aatccaaaaa ctatcgttcc attctga
//