Dbfetch

LOCUS       NM_001267964            1116 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans SUPpressor (sup-26), partial mRNA.
ACCESSION   NM_001267964
VERSION     NM_001267964.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 1116)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 1116)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1116)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 1116)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003281).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1116
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="III"
     gene            <1..>1116
                     /gene="sup-26"
                     /locus_tag="CELE_R10E4.2"
                     /db_xref="GeneID:175551"
                     /db_xref="WormBase:WBGene00006331"
     CDS             1..1116
                     /gene="sup-26"
                     /locus_tag="CELE_R10E4.2"
                     /standard_name="R10E4.2k"
                     /note="Product from WormBase gene class sup;
                     Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="SUPpressor"
                     /protein_id="NP_001254893.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00006331"
                     /db_xref="EnsemblGenomes-Tr:R10E4.2k"
                     /db_xref="GeneID:175551"
                     /db_xref="GOA:D5MCR5"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="UniProtKB/TrEMBL:D5MCR5"
                     /db_xref="WormBase:WBGene00006331"
                     /translation="MNASSAPQQQQQQQQPQQGQAPQQQQQGPPQHQYQQQRPFHGTN
                     LYIRGLMPNTNDDLLREMCSKYGNIASTKAIMDKATNNCKGYGFVDFESPQAAAAAVD
                     GLNTEGVQAQMAKLQQQEQDPTNLYIANLPLDFTEQMLETELNKFGMVISTRILRTPD
                     NQSRGVGFARMDSKEKCEVIISALNGGRFDTMSKEGPALLIKQADTGRKSKHSMNNPE
                     MLQRMQYPQVYQSYYGYHPAAVYQQHYDVNSLASQMGGMHVGGGNPQANGGGDMYGAH
                     MYGQNAGGQGGQGVGQGGQADESTINGQDNVFTPLLLSSLNLFSLSILSNQSSLQKKT
                     QCAAARAAINTHVHIVSPLPDPQNLLLFLNPKTIVPF"
ORIGIN      
        1 atgaacgcat cttcggctcc acaacaacaa cagcaacaac agcagccaca acaagggcaa
       61 gctccccagc aacaacaaca gggaccacca caacatcaat atcaacaaca acgcccattc
      121 catggaacta atctctacat tcgcggtctc atgccaaaca ccaacgatga tctccttcgt
      181 gaaatgtgct ccaagtacgg aaacattgca tcgaccaaag ctattatgga taaagcaacc
      241 aacaattgca agggatacgg atttgttgac tttgaatctc cacaagccgc tgctgcagca
      301 gttgacgggc tcaacactga aggagttcaa gcacaaatgg caaagcttca acaacaagag
      361 caagatccaa ccaacttgta cattgccaac ttgccattgg acttcaccga acaaatgctc
      421 gagactgagc tcaacaagtt tggaatggtg atctctacac gtattcttcg tactccagac
      481 aatcagtcgc gtggagtcgg attcgccaga atggattcga aggaaaagtg cgaagttatc
      541 atttctgcgt tgaatggtgg tcgcttcgat actatgtcaa aggaaggtcc agccctgctc
      601 attaagcaag ccgataccgg caggaagagt aagcactcga tgaacaatcc tgaaatgctc
      661 cagcgaatgc aatatccaca agtctatcaa tcgtactatg gataccatcc agctgcagtc
      721 taccaacaac actatgacgt taactcgttg gcttcacaga tgggcggtat gcatgtcggt
      781 ggtggaaatc cacaggcgaa tggtggaggt gacatgtatg gagcacatat gtacggacag
      841 aatgccggtg gacaaggtgg acaaggagtc ggacaaggcg gacaggccga tgaatccaca
      901 ataaatggac aggacaacgt cttcactcca cttcttcttt cgtctctaaa cctcttctct
      961 ctctcaatcc tttccaacca atcatctcta caaaaaaaga cacagtgtgc tgccgcgcgc
     1021 gccgcaatca atacccatgt tcatattgtt agcccgctcc ccgatccaca aaaccttctt
     1081 ctttttctca atccaaaaac tatcgttcca ttctga
//