Dbfetch

LOCUS       NM_001267963            1431 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans SUPpressor (sup-26), partial mRNA.
ACCESSION   NM_001267963
VERSION     NM_001267963.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 1431)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 1431)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1431)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 1431)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003281).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1431
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="III"
     gene            <1..>1431
                     /gene="sup-26"
                     /locus_tag="CELE_R10E4.2"
                     /db_xref="GeneID:175551"
                     /db_xref="WormBase:WBGene00006331"
     CDS             1..1431
                     /gene="sup-26"
                     /locus_tag="CELE_R10E4.2"
                     /standard_name="R10E4.2q"
                     /note="Product from WormBase gene class sup;
                     Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="SUPpressor"
                     /protein_id="NP_001254892.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00006331"
                     /db_xref="EnsemblGenomes-Tr:R10E4.2q"
                     /db_xref="GeneID:175551"
                     /db_xref="GOA:D5MCR3"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR035979"
                     /db_xref="UniProtKB/TrEMBL:D5MCR3"
                     /db_xref="WormBase:WBGene00006331"
                     /translation="MPPTAQNSQQPYPRSDKAGGHLLHYSSSSHQHQNHQHYHSSSSN
                     QQFNRPPPPPHNSQHHHHHNNSRMNASSAPQQQQQQQQPQQGQAPQQQQQGPPQHQYQ
                     QQRPFHGRVQNHMRGSGPFGNSNGYGRYTAPRGDQQHHDSTPLSSTNLYIRGLMPNTN
                     DDLLREMCSKYGNIASTKAIMDKATNNCKGYGFVDFESPQAAAAAVDGLNTEGVQAQM
                     AKLQQQEQDPTNLYIANLPLDFTEQMLETELNKFGMVISTRILRTPDNQSRGVGFARM
                     DSKEKCEVIISALNGGRFDTMSKEGPALLIKQADTGRKSKHSMNNPEMLQRMQYPQVY
                     QSYYGYHPAAVYQQHYDVNSLASQMGGMHVGGGNPQANGGGDMYGAHMYGQNAGGQGG
                     QGVGQGGQADESTINGQDNVFTPLLLSSLNLFSLSILSNQSSLQKKTQCAAARAAINT
                     HVHIVSPLPDPQNLLLFLNPKTIVPF"
ORIGIN      
        1 atgccgccga ctgcccagaa ctcgcaacaa ccgtatccga gaagcgataa agcgggtggc
       61 catctcctcc actattcatc ttcatcacat caacaccaaa atcatcagca ttatcactca
      121 tcctcatcaa accaacagtt taatcgtcct cctcctccac ctcataattc tcaacatcat
      181 catcatcata ataattcaag aatgaacgca tcttcggctc cacaacaaca acagcaacaa
      241 cagcagccac aacaagggca agctccccag caacaacaac agggaccacc acaacatcaa
      301 tatcaacaac aacgcccatt ccatggacgt gtccaaaacc atatgagagg aagcggaccg
      361 tttggaaaca gcaacggcta tggtcgttac acagctccac gtggtgacca gcagcatcac
      421 gactcgactc ctttgagctc gactaatctc tacattcgcg gtctcatgcc aaacaccaac
      481 gatgatctcc ttcgtgaaat gtgctccaag tacggaaaca ttgcatcgac caaagctatt
      541 atggataaag caaccaacaa ttgcaaggga tacggatttg ttgactttga atctccacaa
      601 gccgctgctg cagcagttga cgggctcaac actgaaggag ttcaagcaca aatggcaaag
      661 cttcaacaac aagagcaaga tccaaccaac ttgtacattg ccaacttgcc attggacttc
      721 accgaacaaa tgctcgagac tgagctcaac aagtttggaa tggtgatctc tacacgtatt
      781 cttcgtactc cagacaatca gtcgcgtgga gtcggattcg ccagaatgga ttcgaaggaa
      841 aagtgcgaag ttatcatttc tgcgttgaat ggtggtcgct tcgatactat gtcaaaggaa
      901 ggtccagccc tgctcattaa gcaagccgat accggcagga agagtaagca ctcgatgaac
      961 aatcctgaaa tgctccagcg aatgcaatat ccacaagtct atcaatcgta ctatggatac
     1021 catccagctg cagtctacca acaacactat gacgttaact cgttggcttc acagatgggc
     1081 ggtatgcatg tcggtggtgg aaatccacag gcgaatggtg gaggtgacat gtatggagca
     1141 catatgtacg gacagaatgc cggtggacaa ggtggacaag gagtcggaca aggcggacag
     1201 gccgatgaat ccacaataaa tggacaggac aacgtcttca ctccacttct tctttcgtct
     1261 ctaaacctct tctctctctc aatcctttcc aaccaatcat ctctacaaaa aaagacacag
     1321 tgtgctgccg cgcgcgccgc aatcaatacc catgttcata ttgttagccc gctccccgat
     1381 ccacaaaacc ttcttctttt tctcaatcca aaaactatcg ttccattctg a
//