Dbfetch

LOCUS       NM_001267258            1677 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Suppressor of zyg-1 protein 20 (szy-20),
            partial mRNA.
ACCESSION   NM_001267258
VERSION     NM_001267258.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 1677)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 1677)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1677)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 1677)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003280).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1677
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="II"
     gene            <1..>1677
                     /gene="szy-20"
                     /locus_tag="CELE_C18E9.3"
                     /db_xref="GeneID:174430"
                     /db_xref="WormBase:WBGene00004105"
     CDS             1..1677
                     /gene="szy-20"
                     /locus_tag="CELE_C18E9.3"
                     /standard_name="C18E9.3f"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Suppressor of zyg-1 protein 20"
                     /protein_id="NP_001254187.1"
                     /db_xref="GeneID:174430"
                     /db_xref="GOA:G5EGU9"
                     /db_xref="InterPro:IPR024771"
                     /db_xref="UniProtKB/Swiss-Prot:G5EGU9"
                     /db_xref="WormBase:WBGene00004105"
                     /translation="MSKENVVADSWDDADADPVKELMDKVEKVKLLQRKEEKKEAFFE
                     KVKAEESSGVVSKLQTEEGLGPSAEEPKRVFLRRPKDGFAASENVIEASPPTSADTEE
                     QPVTNVRSRSHHKLNQKEKQPAPTYEERQAAYQAARNRILGTEYKPDNQEIKEIKFID
                     RSKSPETLKMTQQNMVEHYGEELSRELMEQPAEIVPPERQYTPDFTQPPPSVSESGGV
                     YNGPPGFQQKQPNFQPTLQQQSLHQQQYLDNQYMMQMNVQIPIQYHNQTQHQFVPHEA
                     SAISTTSQNSNGDGQNDQAIYYYQAPTQQPMNYIPYNLPNMAYPPPNFQPQGQLHHQM
                     NAGQLHQIQQQQQQCQQIQHQPPQQHQQVINGQVMNQQNQRNQVNSYPQQNGAGRGQN
                     RQPMMYQMPCNSGPTAKPPPLMNQMQNRCMTNNGQNYQNRNMQQQGQQRSYSSQPQNG
                     QFYQNGNSNQNNPNNGRKQQHQPQQQQNKSGKFGQNRNDMQKNNYQPNLQQPPMSQNP
                     IPFGCPPRNVNAIREQHANNGSPNTGAGILGPHPMMSASQWPALQQNRPQ"
ORIGIN      
        1 atgagtaaag aaaatgttgt cgccgatagc tgggatgatg cagatgcgga tccagtcaag
       61 gaattaatgg ataaggttga gaaggtaaaa cttcttcagc ggaaggaaga aaagaaggaa
      121 gcattttttg agaaagtaaa agcagaagag agtagcggtg tcgtttcgaa actccagaca
      181 gaagaaggtc tcggaccatc agctgaagag cctaaacgag tgttccttcg gcgccctaaa
      241 gatggttttg ctgcatctga aaatgtcatc gaagcatcgc caccaacatc tgcagataca
      301 gaagaacagc cagtgacaaa cgtccgatct cgctctcacc acaaattaaa tcaaaaggaa
      361 aaacaacctg ctcctactta tgaggaacga caagctgcat accaagcagc tcgtaacaga
      421 attttgggaa ccgagtacaa acccgataat caggaaatca aagaaatcaa gtttattgat
      481 cgctccaaat cacctgaaac tctcaaaatg actcaacaaa acatggtaga gcactatgga
      541 gaggaattga gccgcgaatt aatggagcag ccagctgaaa ttgtccctcc tgaacggcaa
      601 tatactccag attttacgca gccaccacca tcggtatcgg agagcggcgg agtttacaat
      661 ggaccgcctg ggtttcaaca gaagcaacca aatttccagc caacgttaca acaacaatcg
      721 cttcatcaac aacagtattt ggataatcag tatatgatgc agatgaacgt acaaattccg
      781 atacagtatc ataatcagac ccaacatcag tttgttccgc atgaagcctc agctatttcc
      841 acaacatcac aaaacagcaa cggtgatggt caaaatgatc aagcgatata ttattatcag
      901 gcgcctaccc aacagccaat gaactacatt ccgtacaatc taccaaacat ggcctaccca
      961 cctccaaact tccaacccca aggacaactg caccatcaaa tgaatgcagg acaactacac
     1021 caaattcaac aacaacagca acaatgccaa cagattcaac atcaaccgcc tcagcaacac
     1081 caacaggtta taaatggcca agtgatgaat caacagaacc aaagaaatca ggtgaatagt
     1141 tatccacagc agaatggtgc tggtcgtgga cagaatcgac agccgatgat gtatcagatg
     1201 ccatgcaaca gtgggccgac agcaaagccc ccgccgttga tgaatcaaat gcagaataga
     1261 tgtatgacca acaatggtca aaactatcag aataggaata tgcagcagca aggtcagcag
     1321 cgatcatatt cgtcacagcc tcagaatggt cagttctacc aaaacggaaa ttccaaccag
     1381 aacaatccga ataatggtag aaaacagcag catcagccac agcagcagca gaacaaatca
     1441 ggaaaattcg gacagaatag aaatgatatg caaaagaaca attatcaacc aaatctacag
     1501 caacctccga tgagtcaaaa tccaattcca tttggatgcc caccacgtaa tgtgaatgcg
     1561 attcgagaac aacacgcaaa caatggatcc ccaaacactg gcgctggaat tcttggacca
     1621 catccaatga tgtctgcatc ccaatggcca gcgttgcagc agaatcggcc tcaatag
//