Dbfetch

LOCUS       NM_001136336            1374 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Suppressor of zyg-1 protein 20 (szy-20),
            partial mRNA.
ACCESSION   NM_001136336
VERSION     NM_001136336.2
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 1374)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 1374)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1374)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 1374)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003280).
            On Jun 26, 2012 this sequence version replaced NM_001136336.1.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1374
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="II"
     gene            <1..>1374
                     /gene="szy-20"
                     /locus_tag="CELE_C18E9.3"
                     /db_xref="GeneID:174430"
                     /db_xref="WormBase:WBGene00004105"
     CDS             1..1374
                     /gene="szy-20"
                     /locus_tag="CELE_C18E9.3"
                     /standard_name="C18E9.3e"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Suppressor of zyg-1 protein 20"
                     /protein_id="NP_001129808.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00004105"
                     /db_xref="GeneID:174430"
                     /db_xref="GOA:G5EGU9"
                     /db_xref="InterPro:IPR024771"
                     /db_xref="UniProtKB/Swiss-Prot:G5EGU9"
                     /db_xref="WormBase:WBGene00004105"
                     /translation="MSKENVVADSWDDADADPVKELMDKVEKVKLLQRKEEKKEAFFE
                     KVKAEESSGVVSKLQTEEGLGPSAEEPKRVFLRRPKDGFAASENVIEASPPTSADTEE
                     QPVTNVRSRSHHKLNQKEKQPAPTYEERQAAYQAARNRILGTEYKPDNQEIKEIKFID
                     RSKSPETLKMTQQNMVEHYGEELSRELMEQPAEIVPPERQYTPDFTNYIPYNLPNMAY
                     PPPNFQPQGQLHHQMNAGQLHQIQQQQQQCQQIQHQPPQQHQQVINGQVMNQQNQRNQ
                     VNSYPQQNGAGRGQNRQPMMYQMPCNSGPTAKPPPLMNQMQNRCMTNNGQNYQNRNMQ
                     QQGQQRSYSSQPQNGQFYQNGNSNQNNPNNGRKQQHQPQQQQNKSGKFGQNRNDMQKN
                     NYQPNLQQPPMSQNPIPFGCPPRNVNAIREQHANNGSPNTGAGILGPHPMMSASQWPA
                     LQQNRPQ"
ORIGIN      
        1 atgagtaaag aaaatgttgt cgccgatagc tgggatgatg cagatgcgga tccagtcaag
       61 gaattaatgg ataaggttga gaaggtaaaa cttcttcagc ggaaggaaga aaagaaggaa
      121 gcattttttg agaaagtaaa agcagaagag agtagcggtg tcgtttcgaa actccagaca
      181 gaagaaggtc tcggaccatc agctgaagag cctaaacgag tgttccttcg gcgccctaaa
      241 gatggttttg ctgcatctga aaatgtcatc gaagcatcgc caccaacatc tgcagataca
      301 gaagaacagc cagtgacaaa cgtccgatct cgctctcacc acaaattaaa tcaaaaggaa
      361 aaacaacctg ctcctactta tgaggaacga caagctgcat accaagcagc tcgtaacaga
      421 attttgggaa ccgagtacaa acccgataat caggaaatca aagaaatcaa gtttattgat
      481 cgctccaaat cacctgaaac tctcaaaatg actcaacaaa acatggtaga gcactatgga
      541 gaggaattga gccgcgaatt aatggagcag ccagctgaaa ttgtccctcc tgaacggcaa
      601 tatactccag attttacgaa ctacattccg tacaatctac caaacatggc ctacccacct
      661 ccaaacttcc aaccccaagg acaactgcac catcaaatga atgcaggaca actacaccaa
      721 attcaacaac aacagcaaca atgccaacag attcaacatc aaccgcctca gcaacaccaa
      781 caggttataa atggccaagt gatgaatcaa cagaaccaaa gaaatcaggt gaatagttat
      841 ccacagcaga atggtgctgg tcgtggacag aatcgacagc cgatgatgta tcagatgcca
      901 tgcaacagtg ggccgacagc aaagcccccg ccgttgatga atcaaatgca gaatagatgt
      961 atgaccaaca atggtcaaaa ctatcagaat aggaatatgc agcagcaagg tcagcagcga
     1021 tcatattcgt cacagcctca gaatggtcag ttctaccaaa acggaaattc caaccagaac
     1081 aatccgaata atggtagaaa acagcagcat cagccacagc agcagcagaa caaatcagga
     1141 aaattcggac agaatagaaa tgatatgcaa aagaacaatt atcaaccaaa tctacagcaa
     1201 cctccgatga gtcaaaatcc aattccattt ggatgcccac cacgtaatgt gaatgcgatt
     1261 cgagaacaac acgcaaacaa tggatcccca aacactggcg ctggaattct tggaccacat
     1321 ccaatgatgt ctgcatccca atggccagcg ttgcagcaga atcggcctca atag
//