Dbfetch

LOCUS       NM_001129495            3651 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Serine/threonine-protein kinase par-1
            (par-1), partial mRNA.
ACCESSION   NM_001129495
VERSION     NM_001129495.2
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 3651)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 3651)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 3651)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 3651)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003283).
            On Jun 26, 2012 this sequence version replaced NM_001129495.1.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..3651
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="V"
     gene            <1..>3651
                     /gene="par-1"
                     /locus_tag="CELE_H39E23.1"
                     /db_xref="GeneID:179912"
                     /db_xref="WormBase:WBGene00003916"
     CDS             1..3651
                     /gene="par-1"
                     /locus_tag="CELE_H39E23.1"
                     /standard_name="H39E23.1d"
                     /note="Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Serine/threonine-protein kinase par-1"
                     /protein_id="NP_001122967.2"
                     /db_xref="GeneID:179912"
                     /db_xref="WormBase:WBGene00003916"
                     /translation="MFNAAYSSLLARFMCQPSSSSVTPIPEEEESLIPKRKVSEVVTT
                     APMAPTLTSSGKRRTVKVSPDGDHVTHNRKNSSSHARSTGQSGMSSRSAARRNDQDVH
                     VGKYKLLKTIGKGNFAKVKLAKHVITGHEVAIKIIDKTALNPSSLQKLFREVKIMKQL
                     DHPNIVKLYQVMETEQTLYLVLEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQY
                     LHSKNIIHRDLKAENLLLDQDMNIKIADFGFSNTFSLGNKLDTFCGSPPYAAPELFSG
                     KKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLL
                     KKFLVINPQRRSSLDNIMKDRWMNVGYEDDELKPFIEPPKDQIDEQRIEKLIQIFQLG
                     FNKAAILESVEKEKFEDIHATYLLLGERKSDMDASEITMAQSLLSHSSINVSSSLGQH
                     PAGVITREHVTSSSASGSSASPSRYSRSSATATGASITAGSALASAANAQKHQQSSAA
                     PSSGSSSSRRSSQNDAAATAAGGTVVMSGTRHGGVQMRAQPTSRQATISLLQPPSYKP
                     SSNTTQIAQIPPLFNRNSTATSSAAQPSTGITGTRKIADPKGRIPLNSTAVQGHRTAT
                     GAVAANNGGIPSHRDHAQQQQYMNQLTSSTMMSKLINKTPAAGGTAATSSSSSSSATS
                     TAPLQKSGSQISHAPTEPVIREDDDENNSENQNGNVPLIGGVGPQTSPAVQVPTEDAT
                     SSSDKEQQQQKASSETPKESKPSMIHQSPSMPPSQMMTAMESLKLSESGQTGGPTVAT
                     GGPPQRATSQQMSRSATTNSANMGASSGGAAAAASATNQLSGAPSSTGASSQQYHPKA
                     PSSSSSSSTNPPHQHQLTHNASFSVTPSSYQIPTSTAVNVTSTGMPTSSSSSAFPRNT
                     RNRQTFHGKTEKDKGGDDSSDEIGETPGNVSIGATGPSANNAEATIWSKLSKLTRRSS
                     TAAAHQPRGSSLHHSMSMTQSPSQLSSRFTSNYVAPIVRSKPPAPVSTPAAPSATAPI
                     PVIVSPAVTKMLKENRRKLSEEAMAIRRDHNRESMTQPVSGRAGTIGASQGQQTAAAL
                     AAIREQSGPIAPGAGQVAPSLPIHEGDVKPRSLRFTWSMKTTSSLAPDDMMREIRKVL
                     DANGCDYEQRERYMILCVHGDPNTDSLVQWEMEVCKLPRLSLNGVRFKRISGTSIGFK
                     NIASKIAQELNL"
ORIGIN      
        1 atgttcaatg cggcatactc gtcgttactc gctagattta tgtgccagcc aagtagttca
       61 tctgtgacgc ctattccgga agaggaggaa tctctgatcc cgaagcgaaa agtgtctgaa
      121 gtggtcacta cagctccgat ggctcccaca ctaacttcat ctgggaaacg gcgaacggtg
      181 aaagtgtcac ctgatggaga tcatgtcaca cataaccgaa aaaactcttc atcacatgca
      241 cgatctactg gacaatcggg tatgtcaagt cgatcggcag cacgacgcaa cgatcaggat
      301 gtacacgttg gaaagtataa gctattgaag actattggaa agggaaattt tgcaaaggta
      361 aaactcgcaa agcacgtgat aaccggacat gaagtcgcta taaaaattat cgacaagact
      421 gctctgaacc catcgagtct tcaaaaattg ttccgagaag tgaaaattat gaaacaattg
      481 gatcatccga atattgtgaa attatatcaa gtgatggaaa ctgaacagac actgtattta
      541 gtactcgaat atgcatccgg tggtgaagta tttgattatt tggttgcaca cggaagaatg
      601 aaagagaaag aagcaagagc caaatttcga caaattgtct ctgctgttca atatttgcat
      661 tcgaaaaata taattcatcg agatttgaaa gctgaaaatt tgcttctcga tcaagatatg
      721 aatattaaaa ttgctgattt tggattttcg aataccttct cacttggaaa caaactcgac
      781 acattttgtg gatctccacc gtacgctgct ccagaattat tttccggtaa aaagtacgat
      841 ggtcctgaag tagatgtttg gagtcttggt gtaattctct atactcttgt atccggaagt
      901 ctaccatttg atggacaaaa tttgaaagag cttcgagaac gtgtgctccg tggaaaatac
      961 cgtatcccgt tctatatgtc aacggattgt gagaatttgt tgaagaaatt ccttgttatc
     1021 aatccacaaa ggagatcatc attggataat attatgaaag atcgatggat gaatgtggga
     1081 tatgaagatg atgagcttaa gccatttatt gagccaccaa aagatcaaat tgatgaacag
     1141 agaattgaga aattgattca gatcttccaa ctcggattca acaaagccgc cattttggaa
     1201 agcgtcgaga aggaaaagtt tgaagatatt catgcaacgt atttgctttt aggagaacga
     1261 aaatctgata tggatgccag tgaaatcaca atggcccaat cactgctcag ccattcgtca
     1321 atcaatgttt cgtcgtctct gggtcagcac ccggccggtg ttatcactag ggagcatgtg
     1381 acgtcatcat cagcgtctgg aagctctgct tcaccatccc gatactctcg atcctcagca
     1441 acagccacag gtgcatcaat cactgcagga tcagcgctcg catcggctgc gaatgctcag
     1501 aaacatcagc aatcatcggc agctccatcg tcaggatctt cgtcgtcgag gagaagctcg
     1561 caaaacgatg cggcagcgac ggcggctggt ggtactgtag tgatgagtgg aacaaggcat
     1621 ggtggagttc agatgagagc tcagccgacg agtcggcaag cgacaatcag tttattgcaa
     1681 ccgccgagtt ataagccttc ctccaacacc acgcaaattg ctcaaattcc gccactattc
     1741 aatagaaact caacggcaac ctcatcagct gctcaacctt caacaggaat caccggtact
     1801 cgaaagattg ctgatccaaa aggacgaatt ccgctcaatt cgactgctgt acaaggacat
     1861 cgaactgcaa caggtgcagt tgcagccaat aatggtggta ttccaagtca tcgggatcat
     1921 gctcagcagc agcagtatat gaatcaactc acctcgtcga caatgatgtc aaagctcatc
     1981 aataagactc cagcggctgg tggtactgca gccacgtcat cttcttcctc atcgtctgcc
     2041 acgtcgacag cgccacttca gaaatctgga tcacaaatct cgcacgcacc gactgaacca
     2101 gtcattcgag aagacgacga cgagaataac agtgagaatc agaatggaaa tgttccattg
     2161 atcggaggtg tcggaccaca aacctctcca gctgttcaag taccaacaga agatgcaact
     2221 tcatcatcag acaaggaaca acagcagcag aaagcatcca gtgagacacc caaagagtcc
     2281 aagccgtcga tgatccacca atctccatca atgcctccat cacagatgat gactgcgatg
     2341 gaatcattga aattgagcga gagtggtcaa acggggggac cgacagtggc gacgggaggt
     2401 ccaccacaac gagccacatc acagcaaatg tctcgttcgg caacaaccaa tagtgcaaat
     2461 atgggtgcat catcaggagg tgctgctgct gctgcttctg ccacaaatca attatcgggt
     2521 gctccttctt ctacgggtgc ttctagtcag caatatcatc caaaagctcc atcatcatct
     2581 tcatcttcat ctacaaatcc accacatcaa catcaactaa cacataacgc gtcgttctcg
     2641 gtgacaccat catcatatca aattccaaca tcaacagctg tgaacgttac ctccactgga
     2701 atgccaacat catcatcttc atcagctttc cctagaaata ctcgtaatcg acagactttc
     2761 catggaaaaa cggagaagga caagggaggc gacgacagtt ctgatgaaat tggagaaact
     2821 ccgggcaatg tttcaattgg agcaactggt ccatcggcca acaatgcaga agcaacaatc
     2881 tggagcaaat tgagcaaatt gacgagacgt agcagcacgg cagccgccca tcagccacgt
     2941 ggatcctcgc ttcaccattc gatgtcgatg acacaaagcc catcccaact gtcgtctcgt
     3001 tttacttcca actatgttgc tccgattgtt cgttcaaagc caccagctcc agtttcaact
     3061 cccgcagctc cttcagcaac ggctccgatt ccagttattg tgtctccagc cgtcacgaaa
     3121 atgctgaaag agaatagaag aaagttgtca gaagaggcaa tggctattcg aagagatcat
     3181 aatcgagaaa gtatgaccca gccagtatca ggacgtgctg gaaccatcgg agcatcacaa
     3241 ggacagcaaa ccgcggcggc tcttgctgcg attcgggaac agtctggccc aattgctcca
     3301 ggtgccggac aagttgcacc atcgcttccg attcatgaag gagacgtcaa gccacgatca
     3361 ttgcggttca cgtggagtat gaagacgact tcttcattgg ctccggatga tatgatgaga
     3421 gaaattcgaa aagttcttga cgctaacggt tgtgactacg agcaacggga acgatacatg
     3481 attctgtgtg tgcacggtga tccgaataca gactcacttg ttcaatggga gatggaggtc
     3541 tgcaagttgc cacgtctcag tctgaatgga gttcgattca aacgaatctc gggaacatcg
     3601 attggcttca agaatatcgc ttcgaaaata gcccaagagc tgaaccttta g
//