Dbfetch

LOCUS       NM_001083218            4446 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans KiDINs220 (vertebrate scaffold protein)
            homolog (kdin-1), partial mRNA.
ACCESSION   NM_001083218
VERSION     NM_001083218.4
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 4446)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 4446)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 4446)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 4446)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003282).
            On Jun 26, 2012 this sequence version replaced NM_001083218.3.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..4446
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="IV"
     gene            <1..>4446
                     /gene="kdin-1"
                     /locus_tag="CELE_F36H1.2"
                     /db_xref="GeneID:178000"
                     /db_xref="WormBase:WBGene00006490"
     CDS             1..4446
                     /gene="kdin-1"
                     /locus_tag="CELE_F36H1.2"
                     /standard_name="F36H1.2c"
                     /note="Product from WormBase gene class kdin;
                     Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="KiDINs220 (vertebrate scaffold protein) homolog"
                     /protein_id="NP_001076687.3"
                     /db_xref="EnsemblGenomes-Gn:WBGene00006490"
                     /db_xref="EnsemblGenomes-Tr:F36H1.2c"
                     /db_xref="GeneID:178000"
                     /db_xref="GOA:Q067Y1"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR011646"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="InterPro:IPR036770"
                     /db_xref="UniProtKB/TrEMBL:Q067Y1"
                     /db_xref="WormBase:WBGene00006490"
                     /translation="MVQTLRRPWQEAASSAFAVASALPVTMNSTQIAELFEQVEHGTT
                     ELRCALTAEISALRNANGESLLTVAVRSGNTAVAKQLAQLDPDAIDETDNEGWSALLN
                     AAHCGHVDIVRLLIDNGASVDQPDLMGWSPLMWAVYKNHLDVVDLLVNAKAHVNLIDE
                     EDGLTPLIVASGRGFSQIVERLIDSDCQVNACDKFGSTALIWAARKGHLPVVQLLLNS
                     GAEVDAVGMYSSTALMLATRGNFIQVVELLLTREPNVNVADQNGLTALGMAARDGYAD
                     ICESLINSGAFVNQCDRFGNWILTSAVRSGNAAIVRMILDKFADINCQDSEKRTPLHL
                     AIDKSFNDIAYILLEKKPNLELKNKDGETPLLRAAKCRHVHLCTYLMSFGAKLAAVDN
                     CGDNALHLALRARSRRLTQALLSNPSDSRLLYRPNKLGQTPYSIDLSNPQPILPLIFG
                     PIDAEDKMDTAMGYDVYSNVLADIVCEPSLSLPLTIGLYAKWGSGKSALLAKLKEAMH
                     SFSRDWLDGVSLSVSFALFFAIFLFFGMFSLTFTMLIAISNSVTAYLISWSVFLLIFI
                     IFCSLIVVVYYGDRKNWYTSMDIANFFARVFSRIRLVYNILTLHAPMNSEDSASMPVS
                     FLFADYHRLSSIGGEQALAKIVATLFEAAETHFGVLPVRLFCCMKPPYQYIDTGFGFT
                     SPFSRTTYRSLQQPNAHQQAGIHGSLRRHCGVPHVILLIVAVFLLIMAQVFGTVWLLS
                     DRDPNNFNLFIAIAFLCGFVMIAIYPLALIIMYSWTNVPRRRVNAAARNAHKLRFEGL
                     MQKLQTEVDLLADMIRSLDAFTRSHTRLVVVVDGLDNCEQERMVQTLDALELLFSARK
                     HRPFITIIAVDPHVIVSAINHNMHSALSGTELTGHDYLKNIISMPFYLHNSALRQLQS
                     KLREKRESMAEWKERFKRQDTFYGSHLSLREADGRTSRKKSTVPNMNSNSVVGRNMND
                     GILGEDYFSNMNPRAMRRIVNALTLTGRLMRAFEIDFSWMSLGHWVSLLEQWPSRMCW
                     LIDRALEVHNNQLLLSEVYYQLKDHIPAQDDLMQLDRNLENFEGFLDSKGIPSAERLT
                     VGHVKKFVPCTSSLDPYLRKLIRERSKGLVDIEAQVGSAGMAIPPNARLLFSDDLTWM
                     SIDTPLVEMKLDAVVNLIRKIDIPSNRLDSILDRFYQLNLCGLVLATCPLPELKDSMQ
                     LPLGDWTLIRLLLETLKVFGSSPPGLRVDKRKALTLREEDEEEEIEEAAEAALNSEKE
                     RAPLLGSVRAEQRRRSTIVQNATELSIDHKCLMEKLSGMDLTETEGDVNEMHFSHFSS
                     STDGPSPMADGFLPASVSAAPSVRFDDNINDLEREASDADSTQSRYDSKENLLEDERS
                     ASPPAHVDLMRFDSGNTSSDFVRSSYRTSSRYRRMSRGDLMRGMHQNDTIRSSMDQSG
                     TGAAPSSSSLMASDEDLNQQTVQRRGGDDFERIQLEQLFNRQSDA"
     STS             3064..3931
                     /gene="kdin-1"
                     /locus_tag="CELE_F36H1.2"
                     /standard_name="F36H1.2"
                     /db_xref="UniSTS:321448"
ORIGIN      
        1 atggttcaaa cactgagaag accgtggcaa gaagcggcaa gcagtgcttt tgccgtcgcc
       61 agtgctcttc cggtgactat gaatagtaca caaattgctg agctcttcga acaggttgag
      121 catggcacca cagaactcag atgtgcactc accgcagaaa tatcagctct cagaaacgct
      181 aatggagaat cacttctcac agttgccgtt cgatcaggaa acacagcagt tgccaaacaa
      241 ttagcacaat tggatccaga cgcaattgat gaaactgaca atgaaggttg gagtgctctt
      301 ctgaatgcag ctcactgtgg tcatgttgac attgttcgat tattaattga taatggagca
      361 tctgttgatc aacctgattt aatgggatgg agtcctctta tgtgggcagt ttataaaaat
      421 catttagatg tggttgatct acttgttaac gcaaaagctc atgtaaatct tattgacgaa
      481 gaagacggac tcacaccgtt aattgtagct tctggacgtg gattttcaca aattgtagag
      541 cgattaattg attcagattg tcaggtaaat gcctgtgaca aattcggaag tactgcatta
      601 atttgggcag ctcgaaaagg acatcttcct gttgtacaac tacttttaaa ttctggagct
      661 gaggtggatg cagttggaat gtactcatcc acagctttaa tgttggcaac acgtggaaac
      721 tttattcaag tagttgagct tcttctgaca cgagaaccaa atgttaatgt agctgatcaa
      781 aatggtttga cagctctcgg aatggcagct cgtgatggat atgctgatat atgtgaatct
      841 cttattaatt cgggtgcttt tgtgaatcag tgtgatagat ttggaaactg gattcttacg
      901 tcagcagttc gaagtggaaa tgcggcaatt gttagaatga ttctcgacaa atttgctgat
      961 atcaattgtc aagactctga aaaacggaca ccacttcatc tggccatcga taaatcattc
     1021 aatgatatcg cctacatttt attggagaaa aaaccgaatt tggaactgaa aaataaggac
     1081 ggtgaaactc cacttcttcg tgctgctaaa tgtcgtcatg tacatctgtg tacctacttg
     1141 atgagtttcg gagctaaact cgctgcagtt gataattgtg gagataatgc acttcatttg
     1201 gcactgagag cacgtagtcg acgattaaca caggcacttt tgtccaatcc atcagattct
     1261 cggttactgt accgacccaa taagcttggt cagacaccgt attccattga cttatcaaat
     1321 cctcaaccta ttctgccact aatttttgga ccaattgatg cggaagataa aatggataca
     1381 gctatgggat atgatgtata ttctaatgtt ttagctgata ttgtgtgtga accttctctt
     1441 tctcttccac ttacaattgg actttacgcc aaatggggat ccggaaaatc agcacttctc
     1501 gcaaaattga aagaggcaat gcacagtttc tcaagggatt ggcttgatgg agtttcgctt
     1561 tcagtttcgt ttgccttatt ctttgccata ttcctctttt ttggaatgtt ctcactaact
     1621 tttacaatgc tcattgccat ttctaactca gtcacagcat atctcatctc atggtccgtc
     1681 tttcttctca ttttcatcat attctgttca ctgattgttg tggtttatta tggggatcgc
     1741 aagaactggt atacttcaat ggatatagcc aatttttttg cacgggtgtt cagtcggatc
     1801 cgattggttt acaacatttt aacacttcat gcaccgatga acagtgaaga tagtgcaagt
     1861 atgcctgtta gttttctctt tgccgactac caccgtcttt cttctattgg aggcgagcaa
     1921 gctcttgcta aaatcgtggc gacattgttc gaggcagctg aaactcattt tggagtgctt
     1981 ccagttcgac ttttctgttg catgaaacca ccataccaat acattgacac tggtttcgga
     2041 ttcacttctc cattttcacg tactacttat cgtagtttac agcaaccaaa tgcgcaccaa
     2101 caagctggaa ttcatggatc tttacgtcgt cactgcggtg ttccccatgt tattcttctg
     2161 atcgttgccg tctttctact aatcatggct caagtttttg gaacagtttg gctactttct
     2221 gatcgagatc cgaataactt caatctattc atagcaattg cattcctttg tggatttgta
     2281 atgattgcca tctatccatt agcattaatt ataatgtatt catggacaaa tgtaccaaga
     2341 cgaagagtca atgcagctgc tcggaatgct cataaattac gatttgaagg tctaatgcaa
     2401 aagttacaga ccgaggttga tcttcttgct gatatgatcc gatcactcga tgctttcact
     2461 agaagtcaca cacgtctcgt tgtggtggtc gatgggctcg ataattgtga gcaggaacga
     2521 atggttcaga ctcttgatgc tcttgagcta ttattctcgg cccgcaagca tcgccccttc
     2581 atcacaatta ttgctgtgga tccacatgta atagtatctg caatcaatca taatatgcat
     2641 tcagcactgt ctggcactga actcactgga cacgactatc tgaaaaacat catcagtatg
     2701 ccgttctatc ttcataattc tgctcttcgt cagctacaat ctaaacttcg tgaaaaacga
     2761 gaatcgatgg cagaatggaa agaaaggttc aaacgtcaag acacattcta tggatcacat
     2821 ctttcattga gagaagctga tggaagaaca agcagaaaga agtccactgt tccaaacatg
     2881 aactcgaata gtgtggttgg tcggaatatg aatgacggaa ttcttggcga agactacttt
     2941 tccaatatga atcctcgtgc catgcgtcgt attgtcaatg ctttaactct aactggacgt
     3001 ctcatgagag cttttgaaat tgacttttca tggatgtcac tcggacattg ggtatctctt
     3061 ctcgaacaat ggccttcacg aatgtgttgg cttattgata gagctcttga agttcacaac
     3121 aatcagcttc ttctatctga agtatactat caactcaagg atcacattcc agctcaggat
     3181 gatttgatgc agctcgacag aaatttggag aattttgaag gtttcctaga ttctaaagga
     3241 atcccatcag cagagagact tactgttgga catgtcaaga aatttgtccc ctgtaccagc
     3301 agtttggatc cttatttgag aaagttgatt cgcgagagaa gtaaaggatt agtggatatt
     3361 gaagcacaag ttggaagtgc aggaatggct attccaccga atgcgagact tttgtttagt
     3421 gatgatttaa catggatgtc gattgatact ccacttgtcg aaatgaagct tgatgcagtt
     3481 gtcaacctga tccgtaaaat agacattcca tcaaatcgcc tcgattcaat tctcgataga
     3541 ttctatcaat taaacttatg tggattggtt cttgccacgt gtccattgcc agaactgaag
     3601 gatagtatgc aattaccact tggtgattgg actttgattc gtttgcttct tgaaactctt
     3661 aaagtatttg gctcctctcc accaggactc cgagtggata aacgaaaagc actgacactc
     3721 cgcgaagagg atgaggaaga ggaaattgaa gaggcagcag aagctgcttt gaactctgaa
     3781 aaagagcgtg ctccacttct tggatctgtg agagctgaac agagaagacg gtccacaatt
     3841 gttcagaatg ccactgagct gagcattgat cacaaatgtc ttatggagaa gttatcggga
     3901 atggatttga ctgaaaccga aggtgatgtc aatgaaatgc atttctctca tttttcgtcg
     3961 tcaactgatg gaccatctcc aatggctgat ggattccttc cagcttcagt ttctgctgct
     4021 ccatcagtca gattcgacga taatattaat gatctggaac gtgaagcttc tgacgctgac
     4081 agtacacaat cccgatacga ttcgaaagaa aatcttcttg aagatgaaag aagtgcttct
     4141 ccaccggcac atgttgattt aatgagattt gacagtggaa atacaagcag tgatttcgta
     4201 cggtccagtt accgtacctc atcgagatat cgtagaatga gccgaggaga cttgatgcga
     4261 ggaatgcacc agaatgacac aatccgaagc agtatggatc aaagtggaac cggagcagcg
     4321 ccgagctcat cgagtttgat ggcatcagat gaagatttga accagcaaac tgtacaacga
     4381 cgtggtggag acgactttga gcgtatccaa cttgaacaac tattcaatcg acaatccgat
     4441 gcttaa
//