Dbfetch

LOCUS       NM_001047758            3024 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Protein vav-1 (vav-1), partial mRNA.
ACCESSION   NM_001047758
VERSION     NM_001047758.1
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 3024)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 3024)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 3024)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 3024)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003284).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..3024
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="X"
     gene            <1..>3024
                     /gene="vav-1"
                     /locus_tag="CELE_C35B8.2"
                     /db_xref="GeneID:181153"
                     /db_xref="WormBase:WBGene00006887"
     CDS             1..3024
                     /gene="vav-1"
                     /locus_tag="CELE_C35B8.2"
                     /standard_name="C35B8.2b"
                     /note="Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Protein vav-1"
                     /protein_id="NP_001041223.1"
                     /db_xref="EnsemblGenomes-Tr:C35B8.2b"
                     /db_xref="GeneID:181153"
                     /db_xref="WormBase:WBGene00006887"
                     /translation="MSRRSTTTSTNFGLSWSLVDVISSSTAVFKVPMNGGCDLWIGCA
                     RWLRDMKVLTTDKNGTMLEFASVLRDGILLCRLANTLVPNGIDQKKIMRTNQPSPFLC
                     CNNINYFAMFCKTYFNLEDADLFTAEDLYYMNGFQKVLKTLSFLSHTKESLSRGVDPF
                     PDTDNNQEGTSNGSEFEDDVEIYQSLHDNIENVDPNRTIYGPITSADPEEQQSEQLYD
                     RIVTNRKPSMNENDLQNTPTLKRNRCIRELYDTEKNYVAQALVTIIKTFYEPLKGIIP
                     TSDYNIIFGNIEEINVLHTALLADLEYPVKVALGLSDATPPRPISLNECVPQTIGEVF
                     IKYRDQFLAYGKYCSNLPDSRKLSNELLKTNEFISRNINELTAQGNCKFGMNDLLCVP
                     FQRLTKYPLLLKELQKKTDLASPDRKSLEEAVEVMEDVCNYINEESRDTNAIKVIDEI
                     EQSITDLSMPLNVKLHDYGRVNLDGEVKMAESTLTQAGKPKQRYIFLFDKVIVVCKAA
                     NKVMAAKTTGASARTNTFTYKNAYVMSELTIDKNASLDVKSGGTITRRTQYVIIMTRD
                     RNENNEITQLTFYFKNEATRNNWMTALLLSKSNVSPTDYLRDTNHKVAFHSFRVDVKN
                     PATCDVCDKLMKGLQYQGYKCESCNMSMHKECLGLKKCEAVRKSTHETRSSQSFNCNR
                     PRFHIHEGDIVVANSNSTPSDLSYLQFAKGDRIEVIKMQGHNRFTGCLINNRNRTGLV
                     HLDHVSQSRTTSMIGLSPIDSPAGSIAPRVVRNESTVLPNKLLSDGSSRSLSGPHGSR
                     SSRNSSSSTINGSMDSVPRQQDYVNTEISEFLWYMGEMERAKAESTLKGTPNGTFLVR
                     YSKNRKQTAISLSYKNDVKHMIIEQNSDGKVYLDEDYIFNSTVELVQYYRSNNLIEIF
                     AALDTCLKNPYSQCKVFKAVHDYDAPSPNNEGKFLSFKTGDIVVLLDTVGEDRGWWKG
                     QVNNKSGFFPLSYVKPYDPATEGSSSPVTPTSSSS"
     STS             1070..1864
                     /gene="vav-1"
                     /locus_tag="CELE_C35B8.2"
                     /standard_name="C35B8.2"
                     /db_xref="UniSTS:312204"
ORIGIN      
        1 atgtcgcgcc gcagcacaac aacatccact aattttgggc tctcgtggag cctcgtcgat
       61 gttatttcaa gtagtaccgc agtttttaag gttcccatga acggcgggtg cgatctctgg
      121 attgggtgcg cccgatggtt gcgtgatatg aaagtgctca caacggataa aaatgggaca
      181 atgcttgaat ttgcttctgt tctcagagac ggaattctcc tctgccgtct tgccaatact
      241 ttggtaccca atggaattga tcagaagaaa attatgcgga caaatcagcc gtcaccattt
      301 ctttgctgca ataacattaa ttactttgca atgttctgca agacatattt caatttggaa
      361 gacgccgatt tgttcacagc tgaggatttg tattatatga atggattcca aaaagttttg
      421 aagacattgt catttctttc gcataccaaa gaatcactca gtagaggtgt agacccgttt
      481 cccgataccg acaataacca agaaggaaca tcaaatggat cggaatttga ggacgatgtg
      541 gaaatttatc agtctctgca tgacaacatt gaaaatgttg acccaaacag gacaatatat
      601 ggcccaatca caagtgcgga tccagaagaa caacaaagtg agcagttgta tgatcggata
      661 gtaactaatc gaaaacctag tatgaatgaa aacgatcttc aaaatacacc gacgttaaaa
      721 cgaaatcgat gtattcgtga actttacgat acggagaaga attacgtggc acaggcactt
      781 gtgacaataa tcaagacatt ttatgagcca ctgaaaggaa taattcccac gagtgactac
      841 aatattattt ttggaaatat tgaagaaatt aatgtattgc atacagcgct gctggcagat
      901 ttagaatatc ctgtaaaagt ggcgttaggg ttatcagatg caactcctcc aagaccgata
      961 tcattgaatg aatgtgttcc acagacgatt ggagaggttt tcatcaaata ccgagatcag
     1021 ttccttgcgt acggaaaata ctgcagtaac cttccagaca gtagaaaact gagcaacgag
     1081 cttctcaaaa ccaatgagtt catctccagg aatattaatg agttgacagc acaaggaaac
     1141 tgcaaatttg gaatgaacga tctcttgtgt gttccatttc aacgcctcac aaaatatcca
     1201 ctattgttaa aggagctaca aaaaaagacg gatttggcta gcccggatcg gaagtctttg
     1261 gaagaagctg tcgaagtaat ggaggatgtc tgcaactaca ttaatgaaga atctcgagac
     1321 acaaatgcaa taaaagtgat tgacgaaatc gagcaaagca tcaccgacct atccatgcca
     1381 ctgaacgtta aacttcacga ctacggacga gtgaacctag acggagaagt aaaaatggcg
     1441 gaaagcacgt taactcaagc tggaaaacct aagcaacgct atattttctt gttcgacaag
     1501 gttattgtgg tatgcaaagc tgcgaacaaa gtgatggcag cgaaaactac aggagcatct
     1561 gcaagaacaa acacatttac ttacaagaat gcctatgtga tgtcagaact taccattgat
     1621 aaaaatgcat cgcttgatgt aaaatctggt ggaacaatta cgcgaagaac acaatacgtg
     1681 attataatga cccgcgatag aaatgagaat aatgaaatca cccagttgac gttttatttc
     1741 aagaatgaag ctactagaaa caactggatg actgcattat tgctgtccaa atcaaatgtt
     1801 tcccctacgg attatcttcg agatacaaat cacaaagtgg catttcattc tttccgggta
     1861 gacgttaaga atccagcaac atgtgatgtt tgtgataaat tgatgaaagg actgcaatat
     1921 cagggatata agtgcgaatc ttgcaacatg tcaatgcata aggagtgttt gggactgaaa
     1981 aaatgcgaag ctgttcggaa atcaacgcac gaaacacgaa gttcacagag cttcaactgt
     2041 aacagacccc gttttcatat tcacgaaggg gatattgtgg tggccaactc caactcaact
     2101 ccatccgacc tttcctatct tcagtttgca aaaggcgatc gcattgaagt gatcaaaatg
     2161 cagggacata atcggttcac tggttgcctc atcaataatc gcaacagaac gggccttgtt
     2221 catctagacc acgtttcaca gtcaagaaca acgtcaatga ttggactcag cccaattgat
     2281 tcgcctgctg gatcgatcgc accgcgtgtc gttcggaatg aatcgacggt gttgccgaat
     2341 aaattgttat ctgatggaag ctcacggagc cttagtggac cacacggaag cagaagttcc
     2401 cgtaactcat catcatctac tattaacggc tcgatggatt cggtgccacg tcagcaagac
     2461 tatgttaata cggaaatatc ggaattccta tggtacatgg gagaaatgga acgagcaaaa
     2521 gccgaaagca cgttaaaagg aactccaaac ggaacgtttt tggtccgata cagtaagaat
     2581 cgaaagcaaa ccgctatcag cttgagttat aaaaatgatg tgaagcatat gatcattgag
     2641 caaaattcgg acggtaaagt gtatctggat gaagattaca ttttcaattc aacagtggag
     2701 cttgtgcaat attatcgcag taacaatttg attgaaattt ttgctgctct tgacacgtgc
     2761 ctcaaaaatc catattccca atgcaaggtt ttcaaagctg ttcatgacta cgatgctcct
     2821 tcaccaaaca acgaaggcaa atttctatca tttaaaactg gtgacattgt tgttctactg
     2881 gacactgttg gtgaggatcg tggatggtgg aagggccagg tgaacaataa gtctggcttc
     2941 tttcctttga gttacgtgaa accatacgat ccggccacag aagggagcag tagtcccgta
     3001 acaccaactt cttctagctc ctga
//