Dbfetch

LOCUS       NM_001047757            2928 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Protein vav-1 (vav-1), partial mRNA.
ACCESSION   NM_001047757
VERSION     NM_001047757.2
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 2928)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 2928)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2928)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 2928)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003284).
            On Jun 26, 2012 this sequence version replaced NM_001047757.1.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..2928
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="X"
     gene            <1..>2928
                     /gene="vav-1"
                     /locus_tag="CELE_C35B8.2"
                     /db_xref="GeneID:181153"
                     /db_xref="WormBase:WBGene00006887"
     CDS             1..2928
                     /gene="vav-1"
                     /locus_tag="CELE_C35B8.2"
                     /standard_name="C35B8.2a"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Protein vav-1"
                     /protein_id="NP_001041222.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00006887"
                     /db_xref="GeneID:181153"
                     /db_xref="WormBase:WBGene00006887"
                     /translation="MNGGCDLWIGCARWLRDMKVLTTDKNGTMLEFASVLRDGILLCR
                     LANTLVPNGIDQKKIMRTNQPSPFLCCNNINYFAMFCKTYFNLEDADLFTAEDLYYMN
                     GFQKVLKTLSFLSHTKESLSRGVDPFPDTDNNQEGTSNGSEFEDDVEIYQSLHDNIEN
                     VDPNRTIYGPITSADPEEQQSEQLYDRIVTNRKPSMNENDLQNTPTLKRNRCIRELYD
                     TEKNYVAQALVTIIKTFYEPLKGIIPTSDYNIIFGNIEEINVLHTALLADLEYPVKVA
                     LGLSDATPPRPISLNECVPQTIGEVFIKYRDQFLAYGKYCSNLPDSRKLSNELLKTNE
                     FISRNINELTAQGNCKFGMNDLLCVPFQRLTKYPLLLKELQKKTDLASPDRKSLEEAV
                     EVMEDVCNYINEESRDTNAIKVIDEIEQSITDLSMPLNVKLHDYGRVNLDGEVKMAES
                     TLTQAGKPKQRYIFLFDKVIVVCKAANKVMAAKTTGASARTNTFTYKNAYVMSELTID
                     KNASLDVKSGGTITRRTQYVIIMTRDRNENNEITQLTFYFKNEATRNNWMTALLLSKS
                     NVSPTDYLRDTNHKVAFHSFRVDVKNPATCDVCDKLMKGLQYQGYKCESCNMSMHKEC
                     LGLKKCEAVRKSTHETRSSQSFNCNRPRFHIHEGDIVVANSNSTPSDLSYLQFAKGDR
                     IEVIKMQGHNRFTGCLINNRNRTGLVHLDHVSQSRTTSMIGLSPIDSPAGSIAPRVVR
                     NESTVLPNKLLSDGSSRSLSGPHGSRSSRNSSSSTINGSMDSVPRQQDYVNTEISEFL
                     WYMGEMERAKAESTLKGTPNGTFLVRYSKNRKQTAISLSYKNDVKHMIIEQNSDGKVY
                     LDEDYIFNSTVELVQYYRSNNLIEIFAALDTCLKNPYSQCKVFKAVHDYDAPSPNNEG
                     KFLSFKTGDIVVLLDTVGEDRGWWKGQVNNKSGFFPLSYVKPYDPATEGSSSPVTPTS
                     SSS"
     STS             974..1768
                     /gene="vav-1"
                     /locus_tag="CELE_C35B8.2"
                     /standard_name="C35B8.2"
                     /db_xref="UniSTS:312204"
ORIGIN      
        1 atgaacggcg ggtgcgatct ctggattggg tgcgcccgat ggttgcgtga tatgaaagtg
       61 ctcacaacgg ataaaaatgg gacaatgctt gaatttgctt ctgttctcag agacggaatt
      121 ctcctctgcc gtcttgccaa tactttggta cccaatggaa ttgatcagaa gaaaattatg
      181 cggacaaatc agccgtcacc atttctttgc tgcaataaca ttaattactt tgcaatgttc
      241 tgcaagacat atttcaattt ggaagacgcc gatttgttca cagctgagga tttgtattat
      301 atgaatggat tccaaaaagt tttgaagaca ttgtcatttc tttcgcatac caaagaatca
      361 ctcagtagag gtgtagaccc gtttcccgat accgacaata accaagaagg aacatcaaat
      421 ggatcggaat ttgaggacga tgtggaaatt tatcagtctc tgcatgacaa cattgaaaat
      481 gttgacccaa acaggacaat atatggccca atcacaagtg cggatccaga agaacaacaa
      541 agtgagcagt tgtatgatcg gatagtaact aatcgaaaac ctagtatgaa tgaaaacgat
      601 cttcaaaata caccgacgtt aaaacgaaat cgatgtattc gtgaacttta cgatacggag
      661 aagaattacg tggcacaggc acttgtgaca ataatcaaga cattttatga gccactgaaa
      721 ggaataattc ccacgagtga ctacaatatt atttttggaa atattgaaga aattaatgta
      781 ttgcatacag cgctgctggc agatttagaa tatcctgtaa aagtggcgtt agggttatca
      841 gatgcaactc ctccaagacc gatatcattg aatgaatgtg ttccacagac gattggagag
      901 gttttcatca aataccgaga tcagttcctt gcgtacggaa aatactgcag taaccttcca
      961 gacagtagaa aactgagcaa cgagcttctc aaaaccaatg agttcatctc caggaatatt
     1021 aatgagttga cagcacaagg aaactgcaaa tttggaatga acgatctctt gtgtgttcca
     1081 tttcaacgcc tcacaaaata tccactattg ttaaaggagc tacaaaaaaa gacggatttg
     1141 gctagcccgg atcggaagtc tttggaagaa gctgtcgaag taatggagga tgtctgcaac
     1201 tacattaatg aagaatctcg agacacaaat gcaataaaag tgattgacga aatcgagcaa
     1261 agcatcaccg acctatccat gccactgaac gttaaacttc acgactacgg acgagtgaac
     1321 ctagacggag aagtaaaaat ggcggaaagc acgttaactc aagctggaaa acctaagcaa
     1381 cgctatattt tcttgttcga caaggttatt gtggtatgca aagctgcgaa caaagtgatg
     1441 gcagcgaaaa ctacaggagc atctgcaaga acaaacacat ttacttacaa gaatgcctat
     1501 gtgatgtcag aacttaccat tgataaaaat gcatcgcttg atgtaaaatc tggtggaaca
     1561 attacgcgaa gaacacaata cgtgattata atgacccgcg atagaaatga gaataatgaa
     1621 atcacccagt tgacgtttta tttcaagaat gaagctacta gaaacaactg gatgactgca
     1681 ttattgctgt ccaaatcaaa tgtttcccct acggattatc ttcgagatac aaatcacaaa
     1741 gtggcatttc attctttccg ggtagacgtt aagaatccag caacatgtga tgtttgtgat
     1801 aaattgatga aaggactgca atatcaggga tataagtgcg aatcttgcaa catgtcaatg
     1861 cataaggagt gtttgggact gaaaaaatgc gaagctgttc ggaaatcaac gcacgaaaca
     1921 cgaagttcac agagcttcaa ctgtaacaga ccccgttttc atattcacga aggggatatt
     1981 gtggtggcca actccaactc aactccatcc gacctttcct atcttcagtt tgcaaaaggc
     2041 gatcgcattg aagtgatcaa aatgcaggga cataatcggt tcactggttg cctcatcaat
     2101 aatcgcaaca gaacgggcct tgttcatcta gaccacgttt cacagtcaag aacaacgtca
     2161 atgattggac tcagcccaat tgattcgcct gctggatcga tcgcaccgcg tgtcgttcgg
     2221 aatgaatcga cggtgttgcc gaataaattg ttatctgatg gaagctcacg gagccttagt
     2281 ggaccacacg gaagcagaag ttcccgtaac tcatcatcat ctactattaa cggctcgatg
     2341 gattcggtgc cacgtcagca agactatgtt aatacggaaa tatcggaatt cctatggtac
     2401 atgggagaaa tggaacgagc aaaagccgaa agcacgttaa aaggaactcc aaacggaacg
     2461 tttttggtcc gatacagtaa gaatcgaaag caaaccgcta tcagcttgag ttataaaaat
     2521 gatgtgaagc atatgatcat tgagcaaaat tcggacggta aagtgtatct ggatgaagat
     2581 tacattttca attcaacagt ggagcttgtg caatattatc gcagtaacaa tttgattgaa
     2641 atttttgctg ctcttgacac gtgcctcaaa aatccatatt cccaatgcaa ggttttcaaa
     2701 gctgttcatg actacgatgc tccttcacca aacaacgaag gcaaatttct atcatttaaa
     2761 actggtgaca ttgttgttct actggacact gttggtgagg atcgtggatg gtggaagggc
     2821 caggtgaaca ataagtctgg cttctttcct ttgagttacg tgaaaccata cgatccggcc
     2881 acagaaggga gcagtagtcc cgtaacacca acttcttcta gctcctga
//