Dbfetch

LOCUS       NM_001029783             933 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Nuclear hormone receptor family member
            nhr-91 (nhr-91), partial mRNA.
ACCESSION   NM_001029783
VERSION     NM_001029783.4
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 933)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 933)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 933)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 933)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003284).
            On Jun 26, 2012 this sequence version replaced NM_001029783.3.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..933
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="X"
     gene            <1..>933
                     /gene="nhr-91"
                     /locus_tag="CELE_Y15E3A.1"
                     /db_xref="GeneID:181621"
                     /db_xref="WormBase:WBGene00003681"
     CDS             1..933
                     /gene="nhr-91"
                     /locus_tag="CELE_Y15E3A.1"
                     /standard_name="Y15E3A.1b"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Nuclear hormone receptor family member nhr-91"
                     /protein_id="NP_001024954.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00003681"
                     /db_xref="EnsemblGenomes-Tr:Y15E3A.1a.1"
                     /db_xref="EnsemblGenomes-Tr:Y15E3A.1a.2"
                     /db_xref="EnsemblGenomes-Tr:Y15E3A.1a.3"
                     /db_xref="GeneID:181621"
                     /db_xref="WormBase:WBGene00003681"
                     /translation="MLTEAVREDRMPGGRNGNSIYSNYKQRRSIIRKTKDYVEEQERR
                     PFQSLPSGKKLIKELVEMDCLDRLINLKGLRINPSANCDIAPACKRLTRIGDEIVEQL
                     VEWTKTLPFFDELPVEAHTHLLTQRWAELVLLSAGYYACSVFTPDSPDTTEMIDETDE
                     ISFTNPQVNLRLLQNRLSLVLGKEIPLEHVAKEAGPLVTRFTTLLHSFSNLKVSPEAY
                     VCIKAITLLHLSADSTLDRSIIDKVNTLQDHFVKTLQIHLHQPGEDAQTTSLAQILDW
                     LPDLRNASSVLLHSKMFYVPFLLCKNPRRLVFDE"
ORIGIN      
        1 atgctaaccg aagcagtgag agaagatcgc atgcccggcg ggagaaatgg gaacagtatc
       61 tatagcaact acaagcagag gaggagtatc attaggaaaa cgaaagatta tgtggaggag
      121 caggagagaa ggccgtttca gagccttcca agtgggaaaa agttaataaa ggaactggtt
      181 gagatggact gcctagaccg gctcatcaac ctaaaaggac tccgaattaa tccatctgca
      241 aactgcgata ttgcccctgc ttgcaaaagg ttaaccagaa taggagatga aattgtggag
      301 caacttgttg agtggacgaa aaccttgccg tttttcgacg aactacccgt agaagcacac
      361 acccaccttt tgacacaacg atgggccgag ctagtattac tatctgctgg atactacgcg
      421 tgctcggtct ttactccgga ctcccccgac acaacagaaa tgatagacga aactgacgag
      481 atctcattca caaacccaca ggtcaacctt cggctacttc aaaatcgatt atcactggtg
      541 ctcggcaaag aaattccatt ggaacacgtg gcgaaagaag ccggtccgct tgtcacccgt
      601 ttcacgaccc tcctccattc gttctcaaat ctcaaggtct ctccggaagc gtacgtctgt
      661 atcaaagcta tcactcttct tcacctctcc gccgactcga cacttgatag gagtatcatc
      721 gacaaggtca acacgcttca ggatcacttt gtcaaaacac ttcaaattca tctgcaccag
      781 ccgggagagg acgcgcagac gacgagcctc gcacagatac ttgactggct tccggatttg
      841 cgaaacgctt cgtcagtgct gcttcattca aaaatgttct acgtcccatt cctgctttgc
      901 aagaatccgc gacgtctagt gttcgacgag tag
//