Dbfetch

LOCUS       NM_001029554            3288 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Myoblast growth factor receptor egl-15
            (egl-15), partial mRNA.
ACCESSION   NM_001029554
VERSION     NM_001029554.4
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 3288)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 3288)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 3288)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 3288)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003284).
            On Aug 25, 2015 this sequence version replaced NM_001029554.3.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..3288
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="X"
     gene            <1..>3288
                     /gene="egl-15"
                     /locus_tag="CELE_F58A3.2"
                     /db_xref="GeneID:181291"
                     /db_xref="WormBase:WBGene00001184"
     CDS             1..3288
                     /gene="egl-15"
                     /locus_tag="CELE_F58A3.2"
                     /standard_name="F58A3.2d"
                     /note="Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="Myoblast growth factor receptor egl-15"
                     /protein_id="NP_001024725.2"
                     /db_xref="EnsemblGenomes-Gn:WBGene00001184"
                     /db_xref="GeneID:181291"
                     /db_xref="WormBase:WBGene00001184"
                     /translation="MSYFLASCLGVGLLSTVSCSLQGLTSHYRENIPRFKHVANERYE
                     VFLGDEIKFDCQTAASKISAFVEWYRNDKLLKNDQIDKDKIRKDNNRMMLHLKNIDVS
                     DQGLWSCRVHNAYGQISRNFTVEVIDFCDYFLFPDIHHLNIPMECVCLWKYNKEAKRS
                     DVNYAAVTGEVCSKYASRMINRARKPLPMIPCFGDHCKEFDTTPVSDFGLPGKPEDDP
                     LVKRVVLKKDDVIVPVHDSEESPSESRTEFINADEKENKEDEEEDYSVSQPVAPDAGL
                     TELNITAEEPPYFKSNDNIVLFNETHALPAGRTLKLNCRAKGYPEPQIIWYKNGKMLK
                     KSSARSGGYEFKFNRWSLEVEDAVVADSGEFHCEALNKVGSAKKYFHVIIVNRMRRPP
                     IIVPNILANQSVNINDTATFHCKVVSDLLPHIIWVRINKINGSYSYYNNSAEEYMFNY
                     TEMDTFDKAHVHHVGDESTLTIFNVSLDDQGIYACLSGNSLGMSMANATLTVNEFMAI
                     HLLTGDEPKIDRWTTSDYIFTTILLFLLLAATLFGILFMVCKQTLHKKGFMDDTVGLV
                     ARKKRVVVSKRPMNEDNENSDDEPSPYQIQIIETPITKKEAARKQRKRMNSENTVLSE
                     YEVDSDPVWEVERSKLSLVHMLGEGAFGEVWKATYKETENNEIAVAVKKLKMSAHEKE
                     LIDLVSEMETFKVIGEHENVLRLIGCCTGAGPLYVVVELCKHGNLRDFLRAHRPKEEK
                     AKKSSQELTDYLEPRKASDKDDIELIPNLTQRHLVQFAWQVAQGMNFLASKKIIHRDL
                     AARNVLVGDGHVLKISDFGLSRDVHCNDYYRKRGNGRLPIKWMALEALDSNVYTVESD
                     VWSYGVLLWEIMTLGGTPYPTIAMPELYANLKEGYRMEPPHLCPQEVYHLMCSCWREK
                     LEERPSFKTIVDYLDWMLTMTNETIEGSQEFNDQFFSERSTASGPVSPMESFQKKRKH
                     RPLSAPVNLPSEVDQNPQHTICDDYESNFSVEPPNDPNHLYCNDNMLKNHIITPETSQ
                     LYIHKVLNEPIGNGYVRQDKLARAVSGVANQSLDSALGSPAWPSYDRPSNKASCLDDE
                     KHHYYYS"
     STS             1219..2156
                     /gene="egl-15"
                     /locus_tag="CELE_F58A3.2"
                     /standard_name="F58A3.2"
                     /db_xref="UniSTS:311920"
ORIGIN      
        1 atgagttatt tccttgcatc ctgcctcggt gtgggcttac tttctacagt ttcttgttct
       61 cttcaaggat tgaccagtca ttacagagaa aatattcccc gtttcaagca tgtagcaaac
      121 gaaagatacg aagtatttct tggagatgag ataaaatttg actgtcaaac cgcggcgtca
      181 aagatttctg cctttgtcga atggtatcgt aatgacaagt tactcaaaaa tgatcaaata
      241 gataaagaca aaattcggaa agataataac aggatgatgc ttcacttgaa gaatattgat
      301 gtttcagatc agggtctttg gtcttgccgc gtacacaacg catatggaca aatatcacga
      361 aattttacag ttgaagttat tgacttttgt gattacttcc tgtttcccga tattcatcat
      421 ttgaacattc cgatggaatg tgtttgttta tggaaataca acaaagaagc aaaacgatct
      481 gatgtgaact atgcagcggt aacaggagaa gtctgctcaa agtacgcatc tcgcatgata
      541 aatagagcac gaaaaccgtt gccaatgatt ccttgctttg gtgatcactg caaagaattt
      601 gacactactc ctgtttcgga ttttggttta cctgggaaac ccgaggacga tcctttagta
      661 aagcgtgttg ttttgaaaaa agatgatgtg attgtgcccg tgcatgactc tgaagaaagt
      721 ccatccgaat ccagaaccga atttatcaat gctgatgaaa aagaaaacaa agaagacgaa
      781 gaagaagact atagtgtttc acaaccggtt gctccagatg cggggctcac tgagctgaat
      841 attactgcgg aagagccacc atatttcaag tcaaacgaca acattgtatt gtttaatgaa
      901 acgcatgctc taccagcagg acgaacattg aaacttaatt gtcgcgcaaa aggataccct
      961 gagccacaga ttatctggta caaaaacggc aaaatgttga agaaaagtag tgctcggtcc
     1021 ggcggatacg aattcaagtt caatagatgg tctttagaag tggaagatgc tgtcgtagca
     1081 gattctgggg agtttcattg tgaagcattg aacaaagttg gaagtgcaaa aaagtatttc
     1141 catgtgatca tagtcaacag aatgagaaga ccgcccatta tcgttccgaa tattttggct
     1201 aatcaatcag taaatattaa tgacactgcc acattccact gcaaagttgt ctctgactta
     1261 ttgcctcata ttatttgggt acgcatcaac aaaatcaatg ggtcgtatag ctactacaac
     1321 aattcagctg aagagtatat gttcaattac acagagatgg acacttttga taaagcgcac
     1381 gtccatcacg ttggtgatga atcgacgctt actattttca atgtgtcgct ggatgatcag
     1441 ggaatatatg cttgtctcag tggaaactca ctggggatgt cgatggcgaa tgccacttta
     1501 acggtgaatg agtttatggc catacatttg ctcactggtg acgaaccgaa gatagataga
     1561 tggacaacat ccgattatat atttacaaca attctgcttt tcttactgct tgctgcaaca
     1621 ttatttggaa ttttgtttat ggtgtgcaaa caaacactac acaaaaaagg attcatggat
     1681 gatactgttg gattagtggc aagaaaaaaa agagtcgtag ttagcaaaag gccaatgaat
     1741 gaagataatg agaattcgga tgatgagcca tcaccttatc aaattcaaat aatagagact
     1801 ccaattacaa agaaagaagc agcgagaaaa caaagaaaac gtatgaattc agaaaacact
     1861 gttctttcgg aatacgaggt tgattcggat ccagtttggg aagttgaaag atcaaaattg
     1921 agtttggttc acatgcttgg cgagggagca tttggagaag tttggaaagc aacatacaaa
     1981 gaaacagaaa acaatgaaat cgcagttgct gtcaaaaaat tgaaaatgtc agctcacgaa
     2041 aaagagctca ttgacttggt cagtgaaatg gaaacattca aagttatagg agaacatgag
     2101 aacgtgttgc gattgattgg atgctgtaca ggcgctggtc cgctttatgt cgttgttgag
     2161 ctgtgcaagc atgggaattt gcgcgatttc ttgagagcac atagacctaa ggaagagaag
     2221 gcaaaaaagt ccagccaaga attgacggat tatttggaac cacgaaaagc atctgataag
     2281 gatgacattg agctcatacc aaatttgaca caacgccatc ttgtacaatt tgcttggcaa
     2341 gtggctcaag gaatgaactt cttggcatca aagaagatca tacatcgtga tttggcagca
     2401 agaaatgttc tcgtcggtga tggacacgtt ctgaaaatat cggattttgg actatcgaga
     2461 gatgtgcact gtaacgatta ttatagaaaa cgtggaaacg gcagacttcc cattaaatgg
     2521 atggctttag aagcgttgga ctcaaatgta tacaccgtgg aaagtgatgt atggtcatat
     2581 ggagttctcc tttgggaaat catgacactt ggtggaactc cctatccaac gattgccatg
     2641 cctgaactct atgctaacct caaagaagga tacagaatgg agccaccaca tttatgtccc
     2701 caagaagtct accatttgat gtgcagctgc tggagagaaa aattggaaga acgaccatct
     2761 tttaaaacaa tcgtagatta tttggattgg atgttaacaa tgacaaatga gactattgag
     2821 ggatcacaag aatttaatga tcaatttttc tccgaaagat ccacggcatc aggtccagtt
     2881 tctcctatgg agtcattcca gaaaaagaga aaacatcgcc ctctttcagc tccagtgaat
     2941 cttccatcag aggtagatca aaacccacaa cacacaattt gcgacgacta tgagtccaat
     3001 ttttctgtag aaccacccaa tgatccgaat catctctact gcaatgacaa tatgctgaaa
     3061 aatcacatta ttacaccgga aacctctcaa ctgtacatcc acaaagtgct caacgaacca
     3121 atcggaaacg ggtatgttcg acaagataaa ttagctcgtg ccgtcagcgg tgttgccaac
     3181 caatctctcg actctgccct cggttcacca gcttggcctt cgtacgaccg tccctctaac
     3241 aaagcttctt gtttagatga tgagaagcat cactactatt actcatag
//