Dbfetch

LOCUS       NM_001029552            2967 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Myoblast growth factor receptor egl-15
            (egl-15), partial mRNA.
ACCESSION   NM_001029552
VERSION     NM_001029552.2
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 2967)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 2967)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2967)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 2967)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003284).
            On Jun 26, 2012 this sequence version replaced NM_001029552.1.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..2967
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="X"
     gene            <1..>2967
                     /gene="egl-15"
                     /locus_tag="CELE_F58A3.2"
                     /db_xref="GeneID:181291"
                     /db_xref="WormBase:WBGene00001184"
     CDS             1..2967
                     /gene="egl-15"
                     /locus_tag="CELE_F58A3.2"
                     /standard_name="F58A3.2b"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Myoblast growth factor receptor egl-15"
                     /protein_id="NP_001024723.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00001184"
                     /db_xref="GeneID:181291"
                     /db_xref="WormBase:WBGene00001184"
                     /translation="MSYFLASCLGVGLLSTVSCSLQGLTSHYRENIPRFKHVANERYE
                     VFLGDEIKFDCQTAASKISAFVEWYRNDKLLKNDQIDKDKIRKDNNRMMLHLKNIDVS
                     DQGLWSCRVHNAYGQISRNFTVEVIDPLKLFDWLTEHRVFDISHLLPKLLPPAEMRRV
                     KSQLGGWEKMNNEQKIVRARHILRLRQINHALGTEFINADEKENKEDEEEDYSVSQPV
                     APDAGLTELNITAEEPPYFKSNDNIVLFNETHALPAGRTLKLNCRAKGYPEPQIIWYK
                     NGKMLKKSSARSGGYEFKFNRWSLEVEDAVVADSGEFHCEALNKVGSAKKYFHVIIVN
                     RMRRPPIIVPNILANQSVNINDTATFHCKVVSDLLPHIIWVRINKINGSYSYYNNSAE
                     EYMFNYTEMDTFDKAHVHHVGDESTLTIFNVSLDDQGIYACLSGNSLGMSMANATLTV
                     NEFMAIHLLTGDEPKIDRWTTSDYIFTTILLFLLLAATLFGILFMVCKQTLHKKGFMD
                     DTVGLVARKKRVVVSKRPMNEDNENSDDEPSPYQIQIIETPITKKEAARKQRKRMNSE
                     NTVLSEYEVDSDPVWEVERSKLSLVHMLGEGAFGEVWKATYKETENNEIAVAVKKLKM
                     SAHEKELIDLVSEMETFKVIGEHENVLRLIGCCTGAGPLYVVVELCKHGNLRDFLRAH
                     RPKEEKAKKSSQELTDYLEPRKASDKDDIELIPNLTQRHLVQFAWQVAQGMNFLASKK
                     IIHRDLAARNVLVGDGHVLKISDFGLSRDVHCNDYYRKRGNGRLPIKWMALEALDSNV
                     YTVESDVWSYGVLLWEIMTLGGTPYPTIAMPELYANLKEGYRMEPPHLCPQEVYHLMC
                     SCWREKLEERPSFKTIVDYLDWMLTMTNETIEGSQEFNDQFFSERSTASGPVSPMESF
                     QKKRKHRPLSAPVNLPSEPQHTICDDYESNFSVEPPNDPNHLYCNDNMLKNHIITPET
                     SQRIPSNNNSMSKPEF"
     STS             1063..2000
                     /gene="egl-15"
                     /locus_tag="CELE_F58A3.2"
                     /standard_name="F58A3.2"
                     /db_xref="UniSTS:311920"
ORIGIN      
        1 atgagttatt tccttgcatc ctgcctcggt gtgggcttac tttctacagt ttcttgttct
       61 cttcaaggat tgaccagtca ttacagagaa aatattcccc gtttcaagca tgtagcaaac
      121 gaaagatacg aagtatttct tggagatgag ataaaatttg actgtcaaac cgcggcgtca
      181 aagatttctg cctttgtcga atggtatcgt aatgacaagt tactcaaaaa tgatcaaata
      241 gataaagaca aaattcggaa agataataac aggatgatgc ttcacttgaa gaatattgat
      301 gtttcagatc agggtctttg gtcttgccgc gtacacaacg catatggaca aatatcacga
      361 aattttacag ttgaagttat tgatccactt aaactgttcg attggctcac tgagcatcga
      421 gtattcgata ttagtcattt attgccaaaa ttgctacctc ctgcggaaat gaggagagtg
      481 aaaagccaat tgggcggatg ggagaagatg aataatgaac agaaaattgt tcgagccagg
      541 cacattctga gattaagaca gatcaatcat gctttgggaa ccgaatttat caatgctgat
      601 gaaaaagaaa acaaagaaga cgaagaagaa gactatagtg tttcacaacc ggttgctcca
      661 gatgcggggc tcactgagct gaatattact gcggaagagc caccatattt caagtcaaac
      721 gacaacattg tattgtttaa tgaaacgcat gctctaccag caggacgaac attgaaactt
      781 aattgtcgcg caaaaggata ccctgagcca cagattatct ggtacaaaaa cggcaaaatg
      841 ttgaagaaaa gtagtgctcg gtccggcgga tacgaattca agttcaatag atggtcttta
      901 gaagtggaag atgctgtcgt agcagattct ggggagtttc attgtgaagc attgaacaaa
      961 gttggaagtg caaaaaagta tttccatgtg atcatagtca acagaatgag aagaccgccc
     1021 attatcgttc cgaatatttt ggctaatcaa tcagtaaata ttaatgacac tgccacattc
     1081 cactgcaaag ttgtctctga cttattgcct catattattt gggtacgcat caacaaaatc
     1141 aatgggtcgt atagctacta caacaattca gctgaagagt atatgttcaa ttacacagag
     1201 atggacactt ttgataaagc gcacgtccat cacgttggtg atgaatcgac gcttactatt
     1261 ttcaatgtgt cgctggatga tcagggaata tatgcttgtc tcagtggaaa ctcactgggg
     1321 atgtcgatgg cgaatgccac tttaacggtg aatgagttta tggccataca tttgctcact
     1381 ggtgacgaac cgaagataga tagatggaca acatccgatt atatatttac aacaattctg
     1441 cttttcttac tgcttgctgc aacattattt ggaattttgt ttatggtgtg caaacaaaca
     1501 ctacacaaaa aaggattcat ggatgatact gttggattag tggcaagaaa aaaaagagtc
     1561 gtagttagca aaaggccaat gaatgaagat aatgagaatt cggatgatga gccatcacct
     1621 tatcaaattc aaataataga gactccaatt acaaagaaag aagcagcgag aaaacaaaga
     1681 aaacgtatga attcagaaaa cactgttctt tcggaatacg aggttgattc ggatccagtt
     1741 tgggaagttg aaagatcaaa attgagtttg gttcacatgc ttggcgaggg agcatttgga
     1801 gaagtttgga aagcaacata caaagaaaca gaaaacaatg aaatcgcagt tgctgtcaaa
     1861 aaattgaaaa tgtcagctca cgaaaaagag ctcattgact tggtcagtga aatggaaaca
     1921 ttcaaagtta taggagaaca tgagaacgtg ttgcgattga ttggatgctg tacaggcgct
     1981 ggtccgcttt atgtcgttgt tgagctgtgc aagcatggga atttgcgcga tttcttgaga
     2041 gcacatagac ctaaggaaga gaaggcaaaa aagtccagcc aagaattgac ggattatttg
     2101 gaaccacgaa aagcatctga taaggatgac attgagctca taccaaattt gacacaacgc
     2161 catcttgtac aatttgcttg gcaagtggct caaggaatga acttcttggc atcaaagaag
     2221 atcatacatc gtgatttggc agcaagaaat gttctcgtcg gtgatggaca cgttctgaaa
     2281 atatcggatt ttggactatc gagagatgtg cactgtaacg attattatag aaaacgtgga
     2341 aacggcagac ttcccattaa atggatggct ttagaagcgt tggactcaaa tgtatacacc
     2401 gtggaaagtg atgtatggtc atatggagtt ctcctttggg aaatcatgac acttggtgga
     2461 actccctatc caacgattgc catgcctgaa ctctatgcta acctcaaaga aggatacaga
     2521 atggagccac cacatttatg tccccaagaa gtctaccatt tgatgtgcag ctgctggaga
     2581 gaaaaattgg aagaacgacc atcttttaaa acaatcgtag attatttgga ttggatgtta
     2641 acaatgacaa atgagactat tgagggatca caagaattta atgatcaatt tttctccgaa
     2701 agatccacgg catcaggtcc agtttctcct atggagtcat tccagaaaaa gagaaaacat
     2761 cgccctcttt cagctccagt gaatcttcca tcagagccac aacacacaat ttgcgacgac
     2821 tatgagtcca atttttctgt agaaccaccc aatgatccga atcatctcta ctgcaatgac
     2881 aatatgctga aaaatcacat tattacaccg gaaacctctc aacgtattcc atcaaacaac
     2941 aatagcatga gcaaacccga attttga
//