Dbfetch

LOCUS       NM_001028847            3579 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Serine/threonine-protein kinase par-1
            (par-1), partial mRNA.
ACCESSION   NM_001028847
VERSION     NM_001028847.2
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 3579)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 3579)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 3579)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 3579)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003283).
            On Jun 27, 2008 this sequence version replaced NM_001028847.1.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..3579
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="V"
     gene            <1..>3579
                     /gene="par-1"
                     /locus_tag="CELE_H39E23.1"
                     /db_xref="GeneID:179912"
                     /db_xref="WormBase:WBGene00003916"
     CDS             1..3579
                     /gene="par-1"
                     /locus_tag="CELE_H39E23.1"
                     /standard_name="H39E23.1a"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Serine/threonine-protein kinase par-1"
                     /protein_id="NP_001024018.1"
                     /db_xref="GeneID:179912"
                     /db_xref="WormBase:WBGene00003916"
                     /translation="MSSASVGKKPEHVNTPPGDNQQKSSKENQKSNKDKQSSNQPPGQ
                     IPHSTNSGTRKSSGSGLKTANLKHPARPSTESSTSSSHHRRPAQEMNGTSTATATGGG
                     GTSGATTTASSGAPAASSGGSSARYSSSGRSHPTSGSSSSHARSTGQSGMSSRSAARR
                     NDQDVHVGKYKLLKTIGKGNFAKVKLAKHVITGHEVAIKIIDKTALNPSSLQKLFREV
                     KIMKQLDHPNIVKLYQVMETEQTLYLVLEYASGGEVFDYLVAHGRMKEKEARAKFRQI
                     VSAVQYLHSKNIIHRDLKAENLLLDQDMNIKIADFGFSNTFSLGNKLDTFCGSPPYAA
                     PELFSGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMST
                     DCENLLKKFLVINPQRRSSLDNIMKDRWMNVGYEDDELKPFIEPPKDQIDEQRIEKLI
                     QIFQLGFNKAAILESVEKEKFEDIHATYLLLGERKSDMDASEITMAQSLLSHSSINVS
                     SSLGQHPAGVITREHVTSSSASGSSASPSRYSRSSATATGASITAGSALASAANAQKH
                     QQSSAAPSSGSSSSRRSSQNDAAATAAGGTVVMSGTRHGGVQMRAQPTSRQATISLLQ
                     PPSYKPSSNTTQIAQIPPLFNRNSTATSSAAQPSTGITGTRKIADPKGRIPLNSTAVQ
                     GHRTATGAVAANNGGIPSHRDHAQQQQYMNQLTSSTMMSKLINKTPAAGGTAATSSSS
                     SSSATSTAPLQKSGSQISHAPTEPVIREDDDENNSENQNGNVPLIGGVGPQTSPAVQV
                     PTEDATSSSDKEQQQQKASSETPKESKPSMIHQSPSMPPSQMMTAMESLKLSESGQTG
                     GPTVATGGPPQRATSQQMSRSATTNSANMGASSGGAAAAASATNQLSGAPSSTGASSQ
                     QYHPKAPSSSSSSSTNPPHQHQLTHNASFSVTPSSYQIPTSTAVNVTSTGMPTSSSSS
                     AFPRNTRNRQTFHGKTEKDKGGDDSSDEIGETPGNVSIGATGPSANNAEATIWSKLSK
                     LTRRDHNRESMTQPVSGRAGTIGASQGQQTAAALAAIREQSGPIAPGAGQVAPSLPIH
                     EGDVKPRSLRFTWSMKTTSSLAPDDMMREIRKVLDANGCDYEQRERYMILCVHGDPNT
                     DSLVQWEMEVCKLPRLSLNGVRFKRISGTSIGFKNIASKIAQELNL"
ORIGIN      
        1 atgagctcgg cgtcagtcgg caaaaaacca gagcatgtga acacgcctcc aggggataat
       61 cagcagaaat catcgaaaga aaaccagaaa tctaataagg ataaacagtc gtcaaatcag
      121 ccacccggtc aaattccgca ttcaacaaat agcggaacaa ggaaatcgag tggaagcgga
      181 ttgaaaactg caaatttgaa acatccggcg cgcccatcaa cagaatcctc aacttcttca
      241 tcacatcatc gacgtcctgc acaagaaatg aacggaacgt cgacggcaac tgccaccggt
      301 ggcggaggaa catctggagc caccacaacg gcatcatcag gagcaccggc tgcttcatcg
      361 ggtggaagct cggctagata ttcgagtagt gggagatccc atccaacgtc tggaagctct
      421 tcatcacatg cacgatctac tggacaatcg ggtatgtcaa gtcgatcggc agcacgacgc
      481 aacgatcagg atgtacacgt tggaaagtat aagctattga agactattgg aaagggaaat
      541 tttgcaaagg taaaactcgc aaagcacgtg ataaccggac atgaagtcgc tataaaaatt
      601 atcgacaaga ctgctctgaa cccatcgagt cttcaaaaat tgttccgaga agtgaaaatt
      661 atgaaacaat tggatcatcc gaatattgtg aaattatatc aagtgatgga aactgaacag
      721 acactgtatt tagtactcga atatgcatcc ggtggtgaag tatttgatta tttggttgca
      781 cacggaagaa tgaaagagaa agaagcaaga gccaaatttc gacaaattgt ctctgctgtt
      841 caatatttgc attcgaaaaa tataattcat cgagatttga aagctgaaaa tttgcttctc
      901 gatcaagata tgaatattaa aattgctgat tttggatttt cgaatacctt ctcacttgga
      961 aacaaactcg acacattttg tggatctcca ccgtacgctg ctccagaatt attttccggt
     1021 aaaaagtacg atggtcctga agtagatgtt tggagtcttg gtgtaattct ctatactctt
     1081 gtatccggaa gtctaccatt tgatggacaa aatttgaaag agcttcgaga acgtgtgctc
     1141 cgtggaaaat accgtatccc gttctatatg tcaacggatt gtgagaattt gttgaagaaa
     1201 ttccttgtta tcaatccaca aaggagatca tcattggata atattatgaa agatcgatgg
     1261 atgaatgtgg gatatgaaga tgatgagctt aagccattta ttgagccacc aaaagatcaa
     1321 attgatgaac agagaattga gaaattgatt cagatcttcc aactcggatt caacaaagcc
     1381 gccattttgg aaagcgtcga gaaggaaaag tttgaagata ttcatgcaac gtatttgctt
     1441 ttaggagaac gaaaatctga tatggatgcc agtgaaatca caatggccca atcactgctc
     1501 agccattcgt caatcaatgt ttcgtcgtct ctgggtcagc acccggccgg tgttatcact
     1561 agggagcatg tgacgtcatc atcagcgtct ggaagctctg cttcaccatc ccgatactct
     1621 cgatcctcag caacagccac aggtgcatca atcactgcag gatcagcgct cgcatcggct
     1681 gcgaatgctc agaaacatca gcaatcatcg gcagctccat cgtcaggatc ttcgtcgtcg
     1741 aggagaagct cgcaaaacga tgcggcagcg acggcggctg gtggtactgt agtgatgagt
     1801 ggaacaaggc atggtggagt tcagatgaga gctcagccga cgagtcggca agcgacaatc
     1861 agtttattgc aaccgccgag ttataagcct tcctccaaca ccacgcaaat tgctcaaatt
     1921 ccgccactat tcaatagaaa ctcaacggca acctcatcag ctgctcaacc ttcaacagga
     1981 atcaccggta ctcgaaagat tgctgatcca aaaggacgaa ttccgctcaa ttcgactgct
     2041 gtacaaggac atcgaactgc aacaggtgca gttgcagcca ataatggtgg tattccaagt
     2101 catcgggatc atgctcagca gcagcagtat atgaatcaac tcacctcgtc gacaatgatg
     2161 tcaaagctca tcaataagac tccagcggct ggtggtactg cagccacgtc atcttcttcc
     2221 tcatcgtctg ccacgtcgac agcgccactt cagaaatctg gatcacaaat ctcgcacgca
     2281 ccgactgaac cagtcattcg agaagacgac gacgagaata acagtgagaa tcagaatgga
     2341 aatgttccat tgatcggagg tgtcggacca caaacctctc cagctgttca agtaccaaca
     2401 gaagatgcaa cttcatcatc agacaaggaa caacagcagc agaaagcatc cagtgagaca
     2461 cccaaagagt ccaagccgtc gatgatccac caatctccat caatgcctcc atcacagatg
     2521 atgactgcga tggaatcatt gaaattgagc gagagtggtc aaacgggggg accgacagtg
     2581 gcgacgggag gtccaccaca acgagccaca tcacagcaaa tgtctcgttc ggcaacaacc
     2641 aatagtgcaa atatgggtgc atcatcagga ggtgctgctg ctgctgcttc tgccacaaat
     2701 caattatcgg gtgctccttc ttctacgggt gcttctagtc agcaatatca tccaaaagct
     2761 ccatcatcat cttcatcttc atctacaaat ccaccacatc aacatcaact aacacataac
     2821 gcgtcgttct cggtgacacc atcatcatat caaattccaa catcaacagc tgtgaacgtt
     2881 acctccactg gaatgccaac atcatcatct tcatcagctt tccctagaaa tactcgtaat
     2941 cgacagactt tccatggaaa aacggagaag gacaagggag gcgacgacag ttctgatgaa
     3001 attggagaaa ctccgggcaa tgtttcaatt ggagcaactg gtccatcggc caacaatgca
     3061 gaagcaacaa tctggagcaa attgagcaaa ttgacgagac gagatcataa tcgagaaagt
     3121 atgacccagc cagtatcagg acgtgctgga accatcggag catcacaagg acagcaaacc
     3181 gcggcggctc ttgctgcgat tcgggaacag tctggcccaa ttgctccagg tgccggacaa
     3241 gttgcaccat cgcttccgat tcatgaagga gacgtcaagc cacgatcatt gcggttcacg
     3301 tggagtatga agacgacttc ttcattggct ccggatgata tgatgagaga aattcgaaaa
     3361 gttcttgacg ctaacggttg tgactacgag caacgggaac gatacatgat tctgtgtgtg
     3421 cacggtgatc cgaatacaga ctcacttgtt caatgggaga tggaggtctg caagttgcca
     3481 cgtctcagtc tgaatggagt tcgattcaaa cgaatctcgg gaacatcgat tggcttcaag
     3541 aatatcgctt cgaaaatagc ccaagagctg aacctttag
//