Dbfetch

LOCUS       NM_001028798           12660 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans KETtiN (Drosophila actin-binding) homolog
            (ketn-1), partial mRNA.
ACCESSION   NM_001028798
VERSION     NM_001028798.3
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 12660)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 12660)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 12660)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 12660)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003283).
            On Apr 20, 2015 this sequence version replaced NM_001028798.2.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..12660
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="V"
     gene            <1..>12660
                     /gene="ketn-1"
                     /locus_tag="CELE_F54E2.3"
                     /db_xref="GeneID:178740"
                     /db_xref="WormBase:WBGene00004130"
     CDS             1..12660
                     /gene="ketn-1"
                     /locus_tag="CELE_F54E2.3"
                     /standard_name="F54E2.3b"
                     /note="Product from WormBase gene class ketn;
                     Confirmed by transcript evidence"
                     /codon_start=1
                     /product="KETtiN (Drosophila actin-binding) homolog"
                     /protein_id="NP_001023969.2"
                     /db_xref="EnsemblGenomes-Gn:WBGene00004130"
                     /db_xref="EnsemblGenomes-Tr:F54E2.3b"
                     /db_xref="GeneID:178740"
                     /db_xref="GOA:Q9NL87"
                     /db_xref="InterPro:IPR003598"
                     /db_xref="InterPro:IPR003599"
                     /db_xref="InterPro:IPR007110"
                     /db_xref="InterPro:IPR010939"
                     /db_xref="InterPro:IPR013098"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR036179"
                     /db_xref="UniProtKB/TrEMBL:Q9NL87"
                     /db_xref="WormBase:WBGene00004130"
                     /translation="MFHNFLKNLRKFRKNGGIKAANGSAKTANGSANGSANGSAVHAA
                     NGGPSSQQARGHEHGAALVNARPPQFLVHPQSVAAKAFETVTFSAKVVGTPTPSLTWQ
                     KSDGTVIQSGGKYKIENGPDGSGRLIIEKVDAHDADMYMLVARNDGGSFQSSVDNKGN
                     ETTLHINNATMKEGGWYRCDATNKHGTTTLKGRVVVNSRQKFNGPAHREMITLRKVDK
                     VERSRTPVNQLQDVSASKSSPKFEGSLQSQQLVEGQSARLEIKYTPVEDPNLRIAWLL
                     NGKGILASSRIVTFTDFGIAALEINPVNVFDQGEYTVVAVNPLGEARVSANIAVIGHG
                     SFIQQQQSGSQFGGTAYQSKGAQAPAGTHLDLPNFHSDLRSQEVFEGQQIHLETKLTP
                     INDPDLRVVWLLDGNELPSNDKYRQTLSHGFASLDIPQTSSNDSGLYSCRAFNKLGES
                     ENQATIIIFAHSSQDLTPKFLSQIQPFHCEQELGRSFFEARIQPINDPTLRVSWLKDG
                     QPLPNANRIQIFQNFGVVSLSLHPTYPEDAGVYTCVLFNSHGQAQSSAELTTVWIDTL
                     QLDSKHADSLPIIGYLDSHQIHIGPQSVERPEEFNSLEAPKFARELAGKIEVMENERV
                     HFEARILPANDVKMTVEWYHNGNPLPAAHRFHPMFDFGYVALDLLYAYPQDSGTYTLV
                     ARNELGEARSNVELVVGTEKVLYLEPHHPEGLERIKELEQDRRQGIAEVEDRTCDAAP
                     KFLNDLPDIQLNEHENIHVDLRATPVNDPTMVIEWFVNGRPLLTGSRVKTLNEFGFIA
                     LDIKGAIAEDSGTYSVRASNLLGEAIRQCVITVTPAGQILSDTQHQESLGKINYLENL
                     NKYGRVEIEDKGPQEPPTFVVPLQADLGDVSPTFFLKNTTNRYLQVEEGEPIHLECQV
                     NPINDNSLKIIWLRDGQSLPHGHRFRTFYDFGFVSLDILGFYAQDAGTYTCRAENSLG
                     QAETVATIRCAPKDAILGAVQHPRSYARIQEIEAPKPAPQEVPDLPHQPPAFVKQLGP
                     AIQCMEGDNVYLEAQVTPTDDNSLTYEWLVNGQPLMKAHRFVLSQDFGYIALNILYCY
                     PEDNGTYTLVVRNRAGEAQSTVDINCGHTGGNFTDSFHPNSLHRIAELETPIQRAEPL
                     PDKEKEVPTIAKPLPATIDSVHESQTLHLEAQVTPIDDNTLRYEWLFNGNPLKASSRY
                     RVLNDFGFVSLDIDYIIAEDSGKYTLVVYNSAGRAETSCEFQVDRLKSILSDTAHPES
                     LRRIREMEQLQPAKPSDDDAAAQPPVFTQQLTGPTEPLKEGQSVHMDCVVQPINDPSL
                     RIEWFHDGRPLMFGSRIRTIHDFGYVGLEFLHIHPEDTGTYTCKATNLIGEATTDIFL
                     ECKPRRNIYLDTHHESSWQKIQEIENRVDEREPTPELTFQPPTFTENLADKEDAQEGQ
                     SIRLECRLIPVNDPTMRVTWTRNGQPLPEASRFMPARNFDYVNLDILALYGEDSGVYT
                     CKAVSAFGEAATSCTVKCAAGKSLLLDTMHDASWKRVQEIENREKLEAVDAEPEKTAP
                     KFVTQLNSSLGELQEGVPIHLEAQVEPTNDNQLTVQWFHNGQPLANGHRFRTRHDFGY
                     VALDILYAFAQDTGEWACVARNSLGEAQTIANFTVLPRGTIYTDSQHPESWQKIQVLE
                     APRAAAPEKPDAEHDAPQFIEPLDSIDRMEFQSAHFQTKVTPQTDPNLRIQWFKDGQP
                     LMNSNRFKLTTDFGYISLDIAHTVPEDSGVYSVKASNAKGDAEVQAQLTVTGNAVILG
                     DTQHEQSWQKIQLIEAPRAPGEEEPDVKHGPPKFVTQLHSLDGVVEGQPSHFEAQFIP
                     FSDPKTSVQWYLNGNPLSASSRRILRNDFGLVSLDLQYTLGEDAGEYSVVVKNSEGED
                     RTSGQLSCTTRAAILGDTQHEQSWQRIQEIEAPRAPGAEPEGPVYEKPSFVQPLQSVG
                     DLPEGSVALLEARLVPVNDPNLRVQWFYNDQPLMESNWISTSNDFGCVSLRIAPVYAR
                     HTGVYSCKAWNDSGNAVTSANVGVQGSEGLLLDTSHPASLQKIQELEAIDKYARLDAP
                     EREYEKPQWVQGFENYENVGEGQTVTLHGLVEPSGDPHLRLEWLLNGTPLRNANRFRQ
                     EYEFGNAILTIVHVLPHDSGVYTCRAWNTQGEASTSATVTTAGYEKILYDSQHPVSWE
                     RIQELEAPKIVEEIEEIVQKEKPNFLTQLESAENVPEGVPLHLESTFQPARDPELKVV
                     WQKNGQPLGASQLVQTKHELGWATLDISSANEDHNGVYTLTITNSEGEAVSTASIRVA
                     GTGPILGNTRHEESWKRIQILEAPKEAEPEAPAPVYDHPAITTQIDDKECNEGDHVHF
                     EALITPVNDPRLQVQWIRNGVPLAHGSKYAIQQDFGICTLDVAYTYPEDEGVYQLRIW
                     NPEGEAVSSATLKCHGKDAILGDVQHQESWKRIQEIEAPKQKLEEADPEPKGPPRFIQ
                     QLTSPGSLVENQPAHFEATVEPVDDPTLTINWFLNGEPMSASSRVKMINDFGWVIMDI
                     AQTEPRDSGEWKCVAKNAAGEAVSTATIEVQGKEVILQDSLQPQSLDRIRQIEAGKPA
                     PEERPDQQFEAPAIVNALQVQGALEEGGSAHLQTQFTPVADPSIKVEWLKDGQPIFHS
                     NRYKMVHDFGFAVLDILHLLKHDAGEYTFRVSNNSGEASTSTSFEVSESSGLILQPQN
                     EQKAKAVEILEDNLRRRPEEIEQELKEATPVFIEPLSAPVETEEGGRAHFTARYEPVN
                     DNQLQVQWYHDGRPLKNGSRIKTINSFGYVVLEISPTYPEDNGEYICRAVNRVGEAVT
                     STKLTCTPKEGIISATQLPERMANAGRRIAEIEAPRPAREDAPDADHGPPKFTSALAG
                     PPELQEGQQAHLECQVTPVADPRLVIEWFHNGQPVNHTNRMKAIHDFGFVVLQLTPAE
                     PQDSGTWTCRATNQHGSDEVSTELKVVGGGGVSYEWQSTAERKERITELEDWIHRPKE
                     DLNLPAVDYPAPSFSQGLTDLGQLNEADATAFVCVLEPIGDPTLRVQWEHNGHPIPYS
                     NRISCTNEFGVATLLIKHLIAADAGEYKCVATNVKGSATSVGKIAVESSTQIDAPQVV
                     QQLVDSVENILEGDSIHLECRVTPINDPRLHVEWLRNGAPLPEASRFKPTFEFGFVSL
                     DILYAYPEDNGDYELVVRNDKGEARSKTKITVLPRPSLDYTSQTHGNQQDSLESHFKQ
                     HSQAKLQLTANDIYNESDKRAPEFRTQLQNIGVLEGEFCRFETQVAPINDPYLKVEWF
                     KDKKPVLLGHRFRSTLDFGFACLDLLYALPDDTGEYHCVATNRHGQTMISAKLACQGA
                     SHVITDSQMPQGLRVSNVKKDNKNIYWSEQGGAVQPKQKQAPQFTIPLRNLQVTENQP
                     ARFECAVTGYPRPKVTWFINGNQCLHGHRFKLNFDGLHYLTVSKSRISDAGEVVAIAR
                     NTEGETISTATLDIFQNDDFRQTKLRPANFKTSDELRERELQWQRDTLGSLGPAFEAA
                     PKPDAQKLMHVERAQSPIEPMESQELIQKFTRPRDDNFYNKLSYVELQKPQFKGMELE
                     EVNLKAGKVEKYQPPVEEMERVNLKAIPEKDQQEVGWERPDWAGQDGTSKLPGADEGR
                     FKKLPTPAPELDVPARDQVKLKTAKPTRGKDLEAGEKVKLKTEKAKIKEIQQKPEQPK
                     EEPIVHKDAVQLKTQQLPKTGIKGDHFTVDREKDLKETPAVVKPVIEETRISNKVYLS
                     VETADSFSQVQRLEYSPRSPRRERIIGFHMIRPQPTKIGQSKQAPPTISQQLKPLQGE
                     LGKAAKFVIEFAGAAPVKVTWLKDGKEIKSTFRTLITTTPTNSSLHIGRLENSHAGEY
                     TVRLENAAGTVESLANLTVAPPTTQGKAPDFSARLNDLRIQQNGPAEFSCQIGGEPKP
                     TIQWFKDGQPLPNDDRFQVVEEGGAYKLKFSNIISTDAGIYEIVAKNGVGEARCKARL
                     NVNLQKTGKGAEEGPRYEAPRFTSQIQPIVVDEGKGAQFSAQFSGFPDPTIRWYRNNE
                     PVKHADGYEISQSKGEAILRISAARNEDVAEYKVEASNPAGKASSVANLVLTPRSGRI
                     AKSTISRGGSASYQSSDKAAADSPHFIAKLSDISARQGHTVKFSAEVDGNPEPTVQWQ
                     FKGKPISASNNVKISRDGKRAILELARVTPDSAGEYQIVIRNDKGAATSQAKLTLSA"
     STS             1608..2039
                     /gene="ketn-1"
                     /locus_tag="CELE_F54E2.3"
                     /standard_name="R05D8.p"
                     /db_xref="UniSTS:324253"
     STS             4108..5290
                     /gene="ketn-1"
                     /locus_tag="CELE_F54E2.3"
                     /standard_name="F54E2.3"
                     /db_xref="UniSTS:311783"
     STS             7055..7967
                     /gene="ketn-1"
                     /locus_tag="CELE_F54E2.3"
                     /standard_name="R05D8.n"
                     /db_xref="UniSTS:322613"
     STS             8419..10109
                     /gene="ketn-1"
                     /locus_tag="CELE_F54E2.3"
                     /standard_name="R05D8.m"
                     /db_xref="UniSTS:323579"
ORIGIN      
        1 atgttccata actttctgaa aaatttgaga aaattccgga agaacggagg aatcaaagca
       61 gcaaatggtt ccgcaaaaac tgcaaacggg tcagcaaacg ggtcggcaaa tggatccgcc
      121 gtacacgcag caaacggcgg accatcatct caacaagcac gcgggcacga acacggagca
      181 gcactcgtga acgcccgtcc cccacaattc ctcgtccatc cacagtccgt cgcagcaaag
      241 gcctttgaaa cagtgacatt cagcgcaaag gtcgtcggaa caccaactcc gtcgctgacg
      301 tggcagaagt ccgacggaac tgttattcag tcgggaggaa agtacaagat cgagaatggg
      361 ccagacggca gcggtcggct tattatcgag aaagtggacg cacacgacgc cgacatgtac
      421 atgttggtag ccagaaatga tggaggatcg ttccagagca gcgtcgacaa caaaggcaac
      481 gagaccacgt tgcacatcaa caatgccaca atgaaagaag gaggatggta ccggtgcgat
      541 gcaaccaaca agcacggaac aactactctg aagggacgcg tcgtggtgaa ctctcgacaa
      601 aagttcaacg ggccggctca cagagaaatg atcacgctga gaaaagttga caaggttgaa
      661 agatcgcgaa caccggtgaa tcagcttcaa gatgtttccg catcaaagtc gtcgccaaag
      721 ttcgaaggat cacttcaatc gcaacaactc gttgaaggac agtcggccag acttgaaatc
      781 aagtacacac cagtcgaaga tccgaatctc agaattgcgt ggctcctcaa tggaaagggt
      841 attttggcct cttccagaat tgtgaccttt accgatttcg gaattgcggc gctggaaatc
      901 aacccagtca atgtattcga tcaaggagag tacactgtcg tcgcagtgaa tccacttggt
      961 gaagctcgag tctctgcaaa catcgcggtc atcggtcatg gaagcttcat ccaacaacaa
     1021 caatcaggaa gccaattcgg aggaactgcc tatcaatcga agggtgcgca agctcctgct
     1081 ggaactcatc ttgatttgcc gaacttccat tctgacttaa gatctcaaga agtttttgaa
     1141 ggtcagcaaa tccacttgga gacaaagctt acaccgatca atgatcctga tcttcgagtt
     1201 gtgtggcttc tcgatggaaa tgaattgcca agcaatgaca aataccgtca aaccctatct
     1261 catggattcg cttcactgga tataccacaa acctcaagca atgatagcgg actctactcg
     1321 tgccgcgcat tcaacaagct cggagaatcc gagaatcagg ccactatcat cattttcgcc
     1381 cactcttctc aagacctgac gccaaagttc ctttctcaaa tccaaccatt ccattgcgaa
     1441 caggaacttg gaagatcgtt ctttgaagcg agaattcagc cgatcaacga tccaactctt
     1501 cgggtgtcat ggcttaagga tggtcaacca ctccccaacg ccaatcgcat ccaaattttc
     1561 caaaactttg gagtcgtgtc actctcgctt catccaactt accccgaaga tgctggagtc
     1621 tatacttgcg tacttttcaa ttcgcatgga caagctcaat catccgctga gctgacaaca
     1681 gtctggatcg acactctcca gcttgactcc aagcatgctg atagtcttcc aattattggc
     1741 taccttgaca gtcatcaaat ccatatcggg ccacaatctg tggagcggcc tgaagagttc
     1801 aactccttgg aggctcccaa gtttgctcgc gagcttgccg gcaaaatcga agtcatggag
     1861 aacgagcgag tgcacttcga ggctagaatc cttccagcca acgatgtgaa gatgacagtg
     1921 gagtggtacc acaatggcaa cccgcttcca gctgctcatc gcttccaccc aatgtttgat
     1981 ttcggctatg ttgctctgga tctgttgtac gcttatccac aagactctgg aacctacaca
     2041 ttggttgcga gaaatgaact aggagaagct cgaagcaacg tggagctggt tgttggcact
     2101 gagaaagtac tttatttgga gccacatcac ccagaaggat tggagagaat taaggagctc
     2161 gagcaagatc gtcgccaagg catcgccgaa gttgaagatc gcacttgtga cgcggccccc
     2221 aaattcctca acgatcttcc ggatatccag ctcaatgagc acgagaatat ccacgttgat
     2281 cttcgcgcaa cgccagtcaa tgacccgacg atggtcattg aatggtttgt caacggacgc
     2341 ccattgttga ctggaagtcg tgtcaagacc ctcaacgaat ttggtttcat tgctctagac
     2401 atcaaaggag cgattgccga agactctgga acctactcgg tcagagccag caatcttctc
     2461 ggggaggcca ttcgccaatg cgtgattact gttacgccag ccggccaaat tctgtccgac
     2521 actcaacatc aagaatctct cggaaaaatc aactatctcg agaatcttaa taagtacgga
     2581 agagtggaga ttgaagataa ggggccacaa gagccaccga cattcgttgt tccacttcaa
     2641 gccgatttgg gagatgtaag tccgactttt tttctgaaaa acactacaaa cagatatttg
     2701 caggttgaag aaggcgagcc aatccatttg gagtgccaag taaacccgat caatgacaac
     2761 tccttgaaaa tcatatggct ccgtgatgga cagtcgcttc cacatggtca ccgtttccgt
     2821 acattctatg atttcggatt tgtgtcactg gatattctcg gcttctacgc tcaagacgcc
     2881 ggaacataca cttgtcgcgc agaaaattcg ctggggcagg ctgaaactgt tgccactatt
     2941 agatgtgcac caaaagatgc catcctcgga gcagttcaac acccaagaag ctatgctaga
     3001 attcaggaga ttgaggcgcc gaaaccagcg ccacaagagg ttccagatct tccacatcag
     3061 ccaccagcat tcgtgaagca gttgggacca gctattcagt gtatggaggg agacaatgtg
     3121 tacctagagg ctcaagtgac acccactgat gataattcgc taacttacga atggctcgtc
     3181 aatggtcagc cactcatgaa ggcccatcgt tttgtattgt ctcaagactt tgggtacatt
     3241 gcgctgaaca ttctctactg ttatccggaa gataatggta cgtacacact agttgtgcga
     3301 aaccgagcag gagaagctca atcgacggtc gacatcaact gtgggcatac tggaggaaat
     3361 ttcaccgact cattccatcc aaactctctc catcgtattg ccgagctcga gactcctatt
     3421 caacgagccg agccacttcc agacaaggaa aaggaagtac caacgattgc caagccactt
     3481 ccagcgacta tcgactcggt ccacgagtca cagactcttc atttggaggc tcaagtcacc
     3541 ccgattgacg ataatactct gagatacgaa tggttgttca acgggaaccc actgaaggca
     3601 tccagcagat atcgtgttct caatgacttt ggatttgtgt ccctcgacat tgactacatc
     3661 attgccgagg acagtggaaa gtacaccttg gtcgtttaca actctgccgg acgtgctgag
     3721 acctcttgcg aattccaagt cgatcgcctg aagtcgattc tctccgacac cgctcatccg
     3781 gaatctcttc gtcgtattcg tgagatggag caacttcaac cagctaagcc atcggatgat
     3841 gatgcagctg ctcagccacc ggtgttcact caacaactca ccggaccaac tgagccactc
     3901 aaggaaggac aatcggttca tatggactgc gttgttcagc cgatcaatga tcctagtctg
     3961 agaatcgagt ggttccacga cggaagacca ttgatgttcg gatcgcgtat ccgtactatt
     4021 cacgactttg gatatgtcgg tcttgagttc cttcacatcc acccagagga tactggaact
     4081 tacacttgca aggctaccaa tcttattggt gaagctacca ccgacatctt cttggagtgc
     4141 aagccacgtc gcaacatcta tcttgacact caccacgagt cttcgtggca gaagattcaa
     4201 gaaatcgaga accgtgtgga tgagcgtgaa ccaacgccgg aacttacatt ccagccacca
     4261 acgttcactg agaacctggc tgacaaggaa gatgctcaag aaggacaatc gattcgtctc
     4321 gagtgccgct tgattccagt taacgatcca acaatgagag tcacttggac aagaaatggt
     4381 cagccacttc cagaagcttc aagattcatg ccagcaagaa actttgatta tgtcaacttg
     4441 gacattcttg cgttgtacgg agaagactca ggtgtctaca cttgcaaagc tgtttcagca
     4501 ttcggagaag ctgccacctc atgcacagtc aagtgtgccg caggaaaatc acttcttctt
     4561 gataccatgc atgatgcttc ctggaagcgt gttcaagaaa ttgaaaaccg tgagaagcta
     4621 gaggcagtgg atgctgagcc agaaaagact gcaccaaagt tcgtcactca gctcaattcc
     4681 tcccttggag agcttcaaga aggagttcca attcatttgg aagcacaagt ggagccaaca
     4741 aacgacaatc agctcacagt acaatggttc cacaatggac aaccacttgc caatggacat
     4801 cgtttccgta ctcgtcacga tttcggatat gtcgctcttg acatcttgta cgcatttgcg
     4861 caggatactg gagaatgggc atgtgttgcc agaaactccc tcggagaggc acagaccatc
     4921 gcaaacttca cagttttgcc acgtggaact atctacaccg attctcaaca cccagaaagt
     4981 tggcagaaga ttcaagtact tgaagcacca cgagctgcag caccggagaa gcctgatgct
     5041 gagcatgatg ctccacaatt tattgagcca ctcgacagta tcgatagaat ggaattccaa
     5101 tcagctcact tccagaccaa ggtcactcca caaacggatc caaaccttag aatccaatgg
     5161 ttcaaggatg gtcagccatt gatgaactct aaccgattca agttgactac cgacttcgga
     5221 tacatctcac tggacattgc tcacactgtt ccagaagaca gcggtgtcta ttcagtcaag
     5281 gcaagcaatg ccaagggaga cgctgaagtt caagctcagc tcactgtaac tggaaacgct
     5341 gttatccttg gagacactca acacgaacaa tcatggcaga agattcagct catcgaagct
     5401 ccaagagccc ctggagagga ggagcctgat gtcaagcacg gaccaccaaa gtttgtcacc
     5461 caattgcata gccttgatgg agtggttgaa ggacagccat ctcactttga agcccagttc
     5521 attccgttct cggatccaaa aacatctgtt caatggtatc tcaacggaaa tccactctct
     5581 gcgtcttctc gcagaatcct acgcaacgat tttggacttg tctccttgga tcttcaatac
     5641 acacttggag aagatgctgg agaatatagc gtcgttgtca agaactctga aggtgaagat
     5701 agaacatctg gacagctgtc gtgtaccact agggccgcga ttcttggaga cactcaacac
     5761 gagcaatcgt ggcagagaat tcaagagatc gaagctccaa gagctccagg cgccgagccg
     5821 gaaggaccgg tctatgagaa gccatccttc gttcaaccgc ttcagtccgt cggagatctg
     5881 cctgaaggat ctgttgctct tctcgaggct cgtcttgtcc cagtcaatga tccaaatctt
     5941 cgagttcaat ggttctataa cgatcagcca ttgatggagt ctaactggat ctcaaccagc
     6001 aacgactttg gatgtgtctc gttgagaatt gctccagtgt acgccagaca taccggagta
     6061 tactcttgca aggcctggaa cgacagtgga aacgctgtca catctgcgaa tgttggagtt
     6121 caaggatcag aaggccttct tctggatact tctcatccag cgtctcttca gaagattcaa
     6181 gagctcgagg ctatcgacaa gtacgcaaga cttgatgcac ctgaaagaga atacgagaaa
     6241 cctcaatggg ttcaaggatt cgaaaactac gaaaatgttg gagaaggaca aactgtcact
     6301 cttcatggac tcgtcgaacc atctggagat ccacatcttc gtctcgaatg gctccttaac
     6361 ggaactccac ttcgaaatgc aaaccgtttc cgtcaagagt atgagttcgg aaacgcaatc
     6421 ctcaccatcg ttcacgtcct cccacacgac tctggtgttt acacctgccg tgcctggaat
     6481 actcaaggag aagcttcaac atctgcgacc gtgactactg ctggctacga gaagattttg
     6541 tacgactcgc agcacccagt ttcatgggag cgtattcaag agcttgaggc tccgaagatc
     6601 gtcgaggaaa ttgaggaaat tgttcaaaag gagaaaccaa acttccttac tcaactggag
     6661 tcggctgaaa atgttccaga aggagtccca cttcacctgg aatctacatt ccagccagct
     6721 agagacccag aacttaaggt tgtttggcag aagaacggcc agccactcgg agcttcacag
     6781 ttggtgcaga ctaaacatga acttggatgg gctacactgg acatttcctc agcaaatgaa
     6841 gatcacaatg gagtgtacac tcttacaatt accaacagcg aaggagaggc tgtgtcgacc
     6901 gcttcaatcc gggtagccgg aactggaccg attcttggaa acactcgtca tgaagaatca
     6961 tggaaacgca tccagattct ggaagctcca aaggaagctg aaccggaagc gccagctcca
     7021 gtatatgacc atccagcaat caccacgcag attgatgata aggagtgcaa tgaaggagac
     7081 cacgttcact ttgaggcact catcactcca gtcaacgatc caagacttca agttcaatgg
     7141 attcgaaacg gagttccact tgctcatgga tcaaagtacg ccattcaaca agactttgga
     7201 atctgcactc tcgatgttgc ctacacttat ccggaagacg aaggtgtcta tcaacttcgt
     7261 atctggaatc cagaaggaga agctgtgtca tctgccacgc tcaagtgtca tggaaaggat
     7321 gcaattctcg gagacgtgca acatcaagaa agctggaagc gtattcaaga aatcgaggcg
     7381 ccaaagcaaa agcttgagga agccgatccg gagccaaagg gtccaccacg gttcatccaa
     7441 cagctcacca gcccgggaag tctcgtggaa aaccaaccag ctcactttga agctactgtc
     7501 gaaccagtcg atgatccaac tcttacgatc aactggttcc ttaatggaga gccaatgtct
     7561 gcgtcgtctc gtgttaagat gatcaatgat tttggatggg tgatcatgga tattgctcaa
     7621 accgaaccaa gagattctgg agaatggaaa tgtgttgcta agaacgcagc tggagaagct
     7681 gtctcaacag caacgattga agttcaagga aaggaagtta tccttcaaga ctctctccag
     7741 ccacaatcac ttgatcgtat tcgccagatt gaagctggaa aacctgctcc agaagagcgc
     7801 ccagatcaac agtttgaggc tccagctatc gtcaacgctc ttcaagtcca gggagcgttg
     7861 gaagagggag gaagtgctca tcttcaaacc caattcactc cagtggctga tccctcgatc
     7921 aaggtggaat ggctcaagga tggtcaaccg atcttccact caaatagata caagatggtt
     7981 cacgacttcg gattcgctgt tttggacatt ttgcatctac tgaaacacga tgctggagag
     8041 tatactttcc gagtttcgaa caactcggga gaagcatcta cttctacaag tttcgaagtt
     8101 tccgagagct ctggtcttat tcttcagcca cagaatgaac agaaggcgaa ggccgtcgaa
     8161 attctcgagg ataacttaag aagacgccct gaagaaatcg agcaagagct taaggaggct
     8221 acaccagtct tcattgagcc actctcggct ccagttgaaa ctgaggaggg cggacgtgct
     8281 catttcacgg ctcgttacga gccagtcaat gacaatcagc ttcaggttca atggtaccat
     8341 gatggtcgcc cattgaagaa tggaagtcgt atcaagacta tcaacagttt tgggtacgtc
     8401 gttcttgaga tcagcccaac atatccagaa gacaacggag agtacatttg tcgtgctgtg
     8461 aaccgtgttg gagaggcagt cacctcgaca aagcttacct gcacacctaa agaaggaatc
     8521 atcagtgcca ctcaacttcc agaacgcatg gcaaacgcgg gaagacgaat tgccgagatt
     8581 gaagcaccaa gaccagctcg tgaagatgct ccagacgctg atcatggacc accaaagttc
     8641 acgtcggcac ttgcaggacc accagagttg caagaaggac aacaggctca cttggagtgc
     8701 caagtcactc cagttgctga tccaagactg gtgatcgagt ggttccacaa tgggcaacca
     8761 gtgaatcaca ctaacagaat gaaggctatc catgatttcg gtttcgtggt tcttcaactg
     8821 acaccagccg aaccacaaga ctctggaacc tggacttgcc gtgccaccaa tcaacatgga
     8881 tctgatgaag tatccacaga gctcaaggtc gtcggcggtg gcggtgtctc atacgaatgg
     8941 cagagcactg cagagcgcaa ggagcgcatc acagagctcg aggactggat tcatagaccg
     9001 aaggaggatc tcaatcttcc agccgtcgac tatccagcac catccttctc tcaaggtctc
     9061 accgatcttg gacagctcaa cgaggccgat gctacagcgt ttgtgtgtgt tttggagcca
     9121 attggagatc caactctccg agttcaatgg gagcataatg gacatccgat cccatactcc
     9181 aatcgtatat cttgcacaaa tgaatttgga gttgccactc ttctcatcaa gcatctcatt
     9241 gccgccgatg ctggagagta caagtgtgtt gccactaacg tcaaggggtc cgctacatct
     9301 gtcggaaaga ttgccgtcga gtcatccact caaattgatg ctccacaagt cgttcaacaa
     9361 ctcgttgaca gtgttgaaaa cattttggaa ggagattcaa tccacctcga atgtcgtgtc
     9421 actccaatca acgacccacg tcttcatgtg gaatggctca gaaatggagc accacttcca
     9481 gaagccagta gattcaagcc aacgttcgag tttggctttg tcagcctgga tattctttat
     9541 gcttacccag aagacaatgg agattacgaa cttgtcgtcc gtaacgacaa gggtgaggct
     9601 cgttccaaga cgaagatcac agttcttcca agaccatctt tggactacac ttctcaaact
     9661 catggaaacc aacaagattc cctggaatct cacttcaaac aacattctca agctaaactt
     9721 cagctcaccg ccaatgacat ctacaacgag agtgacaagc gcgctccaga gtttcgtact
     9781 caacttcaga acatcggagt cttggaagga gagttctgcc gcttcgagac ccaagtcgca
     9841 ccaatcaacg atccatacct caaagttgaa tggttcaagg acaagaagcc agttcttctt
     9901 ggacatcgtt tccgatcaac tctcgacttt ggattcgctt gcctcgatct tctgtatgct
     9961 cttccagatg acactggaga atatcactgc gtcgccacaa accggcatgg tcaaactatg
    10021 atcagcgcta agttggcgtg ccagggagct tctcatgtga tcaccgatag ccagatgcca
    10081 cagggcttga gagtcagcaa tgtgaagaag gacaacaaga acatctactg gagtgaacaa
    10141 ggaggagctg tgcagccaaa acaaaagcag gcaccacagt tcactattcc actccgaaac
    10201 cttcaagtca cagagaatca gccagctcgc tttgaatgcg ctgtaactgg atatccaaga
    10261 ccaaaggtca cctggttcat caatggaaac caatgtctcc atggacaccg cttcaagctc
    10321 aacttcgacg gtcttcacta tcttaccgtc agcaagtcca gaatctcaga cgctggagaa
    10381 gttgttgcga ttgctagaaa caccgaagga gaaacaattt ctactgctac cctcgacatc
    10441 ttccaaaacg atgacttcag acagaccaag ttgagaccgg ctaacttcaa gacatccgat
    10501 gagttgagag aaagagagtt gcagtggcaa cgtgatactt tgggatctct tggcccagcg
    10561 tttgaggctg ctccaaaacc agatgctcaa aaacttatgc acgtggaaag agcccaaagc
    10621 ccgatcgaac caatggagtc ccaggagctt attcagaagt tcacacgccc acgcgacgac
    10681 aacttctaca ataagctttc ttacgtcgag cttcagaagc cacaattcaa gggaatggag
    10741 ctcgaggaag tcaatttgaa agctggtaaa gttgagaagt atcaaccacc agttgaagaa
    10801 atggaacgag tcaatctcaa ggccatccca gaaaaagatc aacaagaggt cggatgggaa
    10861 agacccgact gggccggaca ggatggtacg tcgaagttgc caggagccga tgaaggtcgc
    10921 ttcaagaaac ttccaactcc agcgccagag ctcgacgttc cagccagaga tcaagttaag
    10981 cttaagaccg caaagccaac acgtggaaag gacttggagg ccggtgagaa ggtgaagctg
    11041 aagactgaaa aggcaaagat caaggagatt caacaaaagc cagaacagcc aaaggaagag
    11101 ccaattgttc acaaggatgc ggttcagctt aagactcaac aacttccaaa gactggcatc
    11161 aagggagatc acttcaccgt tgacagagaa aaagatctga aggagactcc agcagtggta
    11221 aagcctgtta ttgaggagac aagaatcagc aacaaggttt acctttctgt ggagactgct
    11281 gactcgttct cacaagttca gcggttggag tacagcccga gaagtccgcg ccgcgaaagg
    11341 atcattggct ttcatatgat tcggccacaa ccaacaaaga tcgggcaatc taagcaagct
    11401 ccaccgacaa tctcccagca gttgaaacca ctgcaaggag aacttggaaa agccgccaag
    11461 tttgttatcg aatttgccgg tgccgctcca gtcaaggtca cttggcttaa ggacggaaag
    11521 gagattaaga gcactttcag aactttgatc actaccactc caacaaactc cagccttcac
    11581 atcggtcgcc ttgaaaactc ccacgccgga gaatacacag tacgactgga gaacgccgct
    11641 ggaaccgttg aatctctagc caatcttact gtcgctccac caaccacaca aggaaaggct
    11701 ccagacttct cggcgcgtct caacgatctc agaatccaac agaatggtcc agctgagttc
    11761 tcctgccaaa tcggaggaga accaaagcca acaatccaat ggttcaagga tggacaacct
    11821 cttccaaatg acgatcgatt ccaagttgtc gaggaaggag gcgcctacaa gctcaagttc
    11881 tcgaacatca tctctaccga tgccggaatc tacgagattg ttgctaagaa cggagtcgga
    11941 gaggctcgct gcaaggctcg cctcaacgta aacctccaga agaccggaaa gggtgccgaa
    12001 gaaggaccac ggtacgaagc gccaagattc acatcccaga ttcaacccat cgttgtcgat
    12061 gaaggaaagg gtgctcagtt tagtgcacag ttctccggat tccctgatcc gacgatccga
    12121 tggtatagaa acaatgagcc cgtgaaacac gccgacggat atgagatttc ccaatcgaag
    12181 ggagaagcca tcctgaggat atctgcagcg agaaatgaag atgttgcaga gtacaaggtt
    12241 gaagctagca atccagccgg aaaggcttca tcggttgcca acttggtttt gactccacga
    12301 tccggaagaa tcgccaagtc gacgatttcc cgtggtggat ctgcatcata tcaatcgtcc
    12361 gacaaggccg ccgccgactc tccacatttt atcgcaaaac tttccgacat ctctgcccga
    12421 caaggacaca ctgtcaaatt cagcgccgag gtggacggaa atccggagcc aactgttcag
    12481 tggcaattca agggaaaacc aatttctgcg tctaacaacg taaagatctc acgtgacggc
    12541 aagcgtgcca ttctcgagct ggctcgagtc acgcccgaca gcgccggaga gtaccagatc
    12601 gtcatcagaa acgacaaggg agctgccacg tcacaagcca agctcacact cagtgcgtaa
//