Dbfetch

LOCUS       NM_001027640            1695 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans GEX Interacting protein (gei-4), partial
            mRNA.
ACCESSION   NM_001027640
VERSION     NM_001027640.3
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 1695)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 1695)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1695)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 1695)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003281).
            On Jun 26, 2012 this sequence version replaced NM_001027640.2.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1695
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="III"
     gene            <1..>1695
                     /gene="gei-4"
                     /locus_tag="CELE_W07B3.2"
                     /db_xref="GeneID:175195"
                     /db_xref="WormBase:WBGene00001561"
     CDS             1..1695
                     /gene="gei-4"
                     /locus_tag="CELE_W07B3.2"
                     /standard_name="W07B3.2f"
                     /note="Product from WormBase gene class gei;
                     Confirmed by transcript evidence"
                     /codon_start=1
                     /product="GEX Interacting protein"
                     /protein_id="NP_001022811.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00001561"
                     /db_xref="EnsemblGenomes-Tr:W07B3.2f.1"
                     /db_xref="EnsemblGenomes-Tr:W07B3.2f.2"
                     /db_xref="GeneID:175195"
                     /db_xref="GOA:Q65CL5"
                     /db_xref="UniProtKB/TrEMBL:Q65CL5"
                     /db_xref="WormBase:WBGene00001561"
                     /translation="MQQNIQYTYSSDPRSGGNQNQQLHGISQFQQNSYQPTTYSNSNA
                     NNFHSSNSATFIPNSVTQTPQRRMGEEKSLVNMLDAYFIDSTTPSTSTSWNNQQPVQM
                     SSIQQSVGSYNQQIPQLKDLQVEGMNVKLSSSPDKGEKDRVKKARQAEAARMRYHRLS
                     NEEKRELNLKRTLAQKRKRQREKEMEELESILRETNDIQEDPDITEQLREKRMRAKWA
                     EAARTRYARMTPEERRAHNTRRRMRQMQNAMSAIKACGMATGDPQKDDEAVRLHIKTQ
                     NAKKAEAARQRYHRMNDDEKRVYNQRRTEAFRRRRMEEEMLLAMPIGRINGEALDRAQ
                     QIVVRNAKRAEAARLRYQRMTPDQRKVAKQEPKEESWPSHEQSDTQIDHDLDLGDSYN
                     QKRYTPKRRRNEMDDMISAGQMAVGSSGTITMGTGTPAKKDDMDALSSLERDVVKRTQ
                     HAQQILLRQRANQSSGTPRSVTPPPQAYIISNGQQQHQQLVGNQGNNGIGQHQVLHQG
                     HMQQQQIQVSHQQSSQSIPQNIYTSGMIIQNQGQQQQGQQQQQGQSQQILNNPYRT"
ORIGIN      
        1 atgcagcaga atatacaata cacatacagt tcggatcccc gctcgggcgg taatcaaaat
       61 cagcagctac acggaatatc gcaatttcaa cagaactcct atcagccgac gacgtattca
      121 aattcaaatg cgaacaattt tcattcctct aattccgcaa cttttatacc taattcagtg
      181 acgcaaacac ctcagcggcg gatgggagaa gagaagagtt tagttaatat gcttgacgct
      241 tattttatcg acagtacgac accttcaaca tcaacgtcgt ggaataatca gcagccagtt
      301 cagatgtctt caatacaaca atcagttgga tcatacaatc aacaaatacc tcagttgaaa
      361 gacctacaag tagaaggaat gaatgttaaa ctctcctcgt cacccgacaa aggcgagaag
      421 gatcgagtaa agaaggcgcg acaggcagaa gccgcccgaa tgcgttatca ccgactatca
      481 aacgaagaga aacgagagtt aaacctgaaa agaacgttgg cgcagaagcg aaaacggcaa
      541 cgtgagaagg agatggagga gctcgaatcg attttgcggg agacaaatga cattcaagag
      601 gatccggaca tcaccgaaca gctcagagag aagagaatgc gggccaagtg ggcagaggcc
      661 gcccgtacac gttacgctag aatgacgccg gaagagcgcc gggcgcacaa tacgcggaga
      721 cgtatgcggc agatgcagaa cgcgatgagc gcgattaagg catgtggaat ggctacagga
      781 gatccacaga aggacgacga ggctgtccgg ttgcacatca agacgcagaa tgcgaaaaaa
      841 gcggaggcgg ctcgtcaacg ataccatcga atgaacgatg acgagaagcg cgtctacaat
      901 caacgaagga cagaagcgtt ccgccgccgt cgtatggaag aagagatgct gctcgccatg
      961 cctataggcc gtatcaacgg agaagcactg gatcgtgctc agcagattgt ggtccgaaac
     1021 gcgaaacgag ccgaagcggc acgtcttcgc taccagcgaa tgacgcctga tcagagaaag
     1081 gtcgcgaaac aagaaccgaa agaagagtct tggccctctc atgagcaatc tgacacgcaa
     1141 atcgaccatg atctcgatct cggagactcg tacaatcaaa aacgctacac tccaaagcgt
     1201 cgtcgcaacg agatggacga catgatcagc gccggacaga tggccgtcgg atcctctgga
     1261 accatcacaa tgggcaccgg cacccccgcc aaaaaggacg atatggacgc tctctcctcg
     1321 ttggaacgtg acgtcgtcaa gcgcacacag cacgctcagc agatccttct ccgacaacgc
     1381 gcgaatcagt cgtcgggaac gccacgctcg gttacaccac cgccacaggc ctatataatc
     1441 tcgaatggtc agcaacagca ccaacagttg gttggaaatc agggaaacaa tgggattgga
     1501 cagcaccagg tgctccatca aggacacatg caacagcagc agattcaggt gtcacaccag
     1561 cagtcgtccc aatcgattcc tcagaacatc tacacttctg gcatgattat ccaaaatcag
     1621 ggacaacagc aacaaggcca gcagcagcag cagggacagt ctcaacaaat attgaacaat
     1681 ccttatagaa cctaa
//