Dbfetch

LOCUS       NM_001027639             525 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans GEX Interacting protein (gei-4), partial
            mRNA.
ACCESSION   NM_001027639
VERSION     NM_001027639.2
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 525)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 525)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 525)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 525)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003281).
            On Jun 26, 2012 this sequence version replaced NM_001027639.1.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..525
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="III"
     gene            <1..>525
                     /gene="gei-4"
                     /locus_tag="CELE_W07B3.2"
                     /db_xref="GeneID:175195"
                     /db_xref="WormBase:WBGene00001561"
     CDS             1..525
                     /gene="gei-4"
                     /locus_tag="CELE_W07B3.2"
                     /standard_name="W07B3.2e"
                     /note="Product from WormBase gene class gei;
                     Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="GEX Interacting protein"
                     /protein_id="NP_001022810.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00001561"
                     /db_xref="EnsemblGenomes-Tr:W07B3.2e.1"
                     /db_xref="EnsemblGenomes-Tr:W07B3.2e.2"
                     /db_xref="GeneID:175195"
                     /db_xref="GOA:H2L0F8"
                     /db_xref="UniProtKB/TrEMBL:H2L0F8"
                     /db_xref="WormBase:WBGene00001561"
                     /translation="MQQNIQYTYSSDPRSGGNQNQQLHGISQFQQNSYQPTTYSNSNA
                     NNFHSSNSATFIPNSVTQTPQRRMGEEKSLVNMLDAYFIDSTTPSTSTSWNNQQPVQM
                     SSIQQSVGSYNQQIPQLKVGDVVNSLFFLCFFLGRISCYSVIFSRNFEFCSSKSAWIF
                     AFERIFQKICSKSR"
ORIGIN      
        1 atgcagcaga atatacaata cacatacagt tcggatcccc gctcgggcgg taatcaaaat
       61 cagcagctac acggaatatc gcaatttcaa cagaactcct atcagccgac gacgtattca
      121 aattcaaatg cgaacaattt tcattcctct aattccgcaa cttttatacc taattcagtg
      181 acgcaaacac ctcagcggcg gatgggagaa gagaagagtt tagttaatat gcttgacgct
      241 tattttatcg acagtacgac accttcaaca tcaacgtcgt ggaataatca gcagccagtt
      301 cagatgtctt caatacaaca atcagttgga tcatacaatc aacaaatacc tcagttgaaa
      361 gtaggagatg tggtaaattc gttgtttttt ctttgttttt ttttggggag aatttcgtgt
      421 tattcagtga ttttttcaag gaattttgaa ttttgcagct cgaaatccgc gtggattttc
      481 gcatttgagc ggatttttca aaaaatttgc tcaaaaagtc gataa
//