Dbfetch

LOCUS       NM_001027203            2709 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Chloride channel protein (clh-1), partial
            mRNA.
ACCESSION   NM_001027203
VERSION     NM_001027203.2
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 2709)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 2709)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2709)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 2709)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003280).
            On Jun 26, 2012 this sequence version replaced NM_001027203.1.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..2709
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="II"
     gene            <1..>2709
                     /gene="clh-1"
                     /locus_tag="CELE_T27D12.2"
                     /db_xref="GeneID:174821"
                     /db_xref="WormBase:WBGene00000528"
     CDS             1..2709
                     /gene="clh-1"
                     /locus_tag="CELE_T27D12.2"
                     /standard_name="T27D12.2b"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Chloride channel protein"
                     /protein_id="NP_001022374.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00000528"
                     /db_xref="EnsemblGenomes-Tr:T27D12.2b"
                     /db_xref="GeneID:174821"
                     /db_xref="GOA:G5EDQ0"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR001807"
                     /db_xref="InterPro:IPR014743"
                     /db_xref="UniProtKB/TrEMBL:G5EDQ0"
                     /db_xref="WormBase:WBGene00000528"
                     /translation="MEDAVVVDEEHRRRGEDTQSSGQSSLPSDIVQFTARPHMLMEDV
                     ECSPIEPTEKEWNEYRDRVQENADQMELLGDDESSDTEDQNDLDEEYEDYYTDSKSTR
                     RETTKEFLTRQFQNIVHFFVEDWFISAALGFITAIFSIFIDMGIEYLIHFRNFMLESL
                     EQFNNYAAFCGWVFYITGLVYLAALVCYGFGKQAVGSGIPEVKVIIHGFQLKNYLSGK
                     TLIAKMIGLTLTIGSGLPVGKEGPFVHIGAIVASLLNKVTAACQYNAFFSNEGRAMEM
                     LSIGCAVGIACTFSAPMGAVLYGIESTSKYFAVKNYWRSFFATTCSAMLFRFAIAFFV
                     PQHIAGTITAYYQTYFPNEVFVVEELPFFIGLGVMTGLLGALFVYYHRRIAFFKRKNR
                     IFQALFGKSPILFTACCAAIFAVLVYPNGLGSYVAGKYTFRETLVDFLSNCTLWKQTN
                     GSEGCPPHMLEHWSGPEGDMMPINSLLIYFLFYFIIVPICITLYIPSGIFVPCFVIGA
                     CGGRIFGEIISMIWPYGLRGLGQPQIYPGLYAVVGAASFTGSVTHSLSIALIVCETTG
                     QLCALLPVLIALMISNAICAFLQPSIYDSIIKINGYPYLADLPPSRMSVHQMKVERIM
                     VKDIFYITRETTYRELREMLLESPTLRSYPFVTDSRSMTLLGSVARKYLLYLIQRKLG
                     PEPELFGHRRRSRTASEIFSTINNLRRGSLAANGAHMSSGNALMTDRNISGNTLLPQS
                     PLHEDQGDRSPLAPLLYAQTNQHEPIVHSLAKRAEILSKKLDMEEVAIDPAPFQLVRG
                     TSLYKVHTLFSLLALNHAYVTEKGRLCGVVAVKELREALSNIYSRGAVVPKQRIRTST
                     FRLNPEQDLDRELQNGHTAEPNGAPIRQPRVTIDVPENAKTDDETR"
ORIGIN      
        1 atggaagacg ccgtcgtcgt cgacgaggag caccgacgac gtggcgaaga cactcaatcg
       61 tcgggccagt cgagccttcc atcggacatt gtgcagttca ctgcgagacc ccacatgtta
      121 atggaagatg ttgaatgcag cccgattgag ccgacggaaa aggaatggaa tgaatatcgt
      181 gatagggttc aagaaaatgc ggatcaaatg gaattgctag gagatgacga gtcgagtgac
      241 acagaagatc agaatgatct ggatgaagag tacgaggatt attatactga ttcaaaatcc
      301 accagacggg aaacaacgaa agaatttttg acgcgtcaat tccaaaatat tgtgcatttc
      361 tttgtcgagg actggttcat ctcggccgca cttggattca tcacggcaat cttttcgatt
      421 ttcatcgata tgggaattga gtatctgatt catttccgaa acttcatgct agagtctctg
      481 gagcaattca acaactacgc ggcgttttgt ggatgggtgt tttatattac tggacttgtg
      541 tatctcgccg cgttggtgtg ctatggattt ggaaaacagg ctgttggatc cggaattccc
      601 gaagtcaaag ttatcattca cggcttccaa ctgaaaaatt atttatctgg gaaaaccttg
      661 atcgcgaaga tgattggact tacgcttact attggatcag gtcttccagt tggtaaagag
      721 ggaccatttg tacatatcgg agctattgtc gcctcactcc tcaacaaagt caccgccgct
      781 tgccaataca acgcattttt ctccaacgaa ggtcgtgcca tggaaatgtt gagcatcggt
      841 tgtgccgtcg gaatcgcttg cacattctcg gcgcctatgg gagctgtact gtacggtatc
      901 gagtcaactt ccaaatattt tgctgtgaaa aactattgga gatcattctt tgccactacc
      961 tgctctgcca tgcttttccg ttttgccatt gcgttctttg tgccacaaca tattgccgga
     1021 accattactg cctattatca aacttatttc ccaaatgagg tgtttgttgt cgaggaattg
     1081 ccatttttca ttggtttggg agttatgact ggtcttctcg gagctctctt cgtctattat
     1141 caccgaagaa tcgcgttctt caaacgaaaa aatcgcatct tccaggccct attcggaaaa
     1201 agcccaatcc tgttcactgc ctgttgtgct gcaattttcg ccgttctcgt ctaccccaat
     1261 ggtttaggaa gctacgtggc cggaaaatac actttccgtg aaaccctcgt cgatttcctc
     1321 tccaactgta ccctctggaa gcaaacgaat gggtctgaag gatgtccacc ccatatgttg
     1381 gagcattggt cgggtccaga aggagatatg atgcctatca actctctttt gatctacttc
     1441 cttttctatt ttatcatcgt tccaatttgt attaccttgt acattccatc aggaatcttc
     1501 gttccatgct tcgtcattgg tgcctgtggt ggaagaattt tcggagaaat tatatcaatg
     1561 atttggccgt atggactccg tggtctcggt cagccacaga tctaccctgg actttatgcc
     1621 gtggttggag ctgcgtcatt caccggatcc gtcactcact ccttgtccat tgctctaatc
     1681 gtttgtgaaa caactggaca gctgtgtgct ctgctacctg tgctcattgc ccttatgatc
     1741 tcaaatgcta tctgtgcttt cctgcaacct tccatttatg attctattat taagattaat
     1801 ggatacccat accttgcaga tttgcctcca tctcgtatga gtgtgcatca aatgaaagtc
     1861 gaacgtatca tggtcaagga catcttctac atcacccgcg agaccaccta ccgtgagctc
     1921 cgcgagatgc tcctcgagag tccaaccctt cgctcctacc catttgtcac cgattcccgc
     1981 tcgatgacac ttctcggctc cgtcgcccgc aagtatcttc tgtaccttat tcaacgtaaa
     2041 ctcggacccg agccagagct cttcggacat cgtagaagaa gtcgcacggc atcggaaatc
     2101 ttcagcacga tcaacaatct aagacgtggc tcgctcgctg cgaatggtgc tcacatgtcg
     2161 tctggaaatg cgttgatgac tgacaggaat atctccggaa acactcttct tccacaatct
     2221 ccacttcatg aagatcaggg agatcgcagt ccattggccc cacttctgta cgctcagact
     2281 aatcaacacg agccgattgt gcactctttg gcaaagagag ctgaaattct atcaaagaaa
     2341 ttggacatgg aagaagtggc aatcgatccg gcaccgttcc agttggttag aggcacctct
     2401 ctttacaagg tccacaccct gttctccctt cttgctctca accatgccta tgttactgaa
     2461 aaaggtcgtc tttgtggtgt agttgccgtg aaggaacttc gtgaggcgct cagtaacatc
     2521 tacagtagag gagctgtcgt cccgaaacag agaatccgaa catccacatt ccgactcaat
     2581 ccagaacaag atcttgaccg tgagctccaa aacggccata cagcggagcc aaacggcgcc
     2641 ccaatcagac aaccacgtgt cacaatcgat gttcctgaaa acgcaaagac ggatgacgaa
     2701 acccgctaa
//