Dbfetch

LOCUS       NM_001026969            2418 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans RFX-like transcription factor daf-19
            (daf-19), partial mRNA.
ACCESSION   NM_001026969
VERSION     NM_001026969.3
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 2418)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 2418)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2418)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 2418)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003280).
            On Jun 26, 2012 this sequence version replaced NM_001026969.2.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..2418
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="II"
     gene            <1..>2418
                     /gene="daf-19"
                     /locus_tag="CELE_F33H1.1"
                     /db_xref="GeneID:174577"
                     /db_xref="WormBase:WBGene00000914"
     CDS             1..2418
                     /gene="daf-19"
                     /locus_tag="CELE_F33H1.1"
                     /standard_name="F33H1.1b"
                     /note="Partially confirmed by transcript evidence"
                     /codon_start=1
                     /product="RFX-like transcription factor daf-19"
                     /protein_id="NP_001022140.1"
                     /db_xref="EnsemblGenomes-Tr:F33H1.1b"
                     /db_xref="GeneID:174577"
                     /db_xref="WormBase:WBGene00000914"
                     /translation="MTNEEPVPSTSSVLSAAEKNVKIETPSRKRKGLDIDALWRKKFK
                     DVENQKSPEKSEKSEKTIKEEPLETHPSGERKLRSASKDSKSLSKETHNTISTRSSSS
                     GTPRKKMEPEDVKPNIKMLKKSLPVSFQCSNLNDGTVGDASVMLDPTKISLHSSSVAY
                     GEESQDEMEVIQHSTDDPNGTREEFDYNQIEYGNAVTPNGTYTLYAPDSNYAPYYQYS
                     NNMQSSPQDNAPYLVPAPQSPVSIDDADSINLPNNQRASPATVNWLFENYEIGEGSLP
                     RCELYDHYKKHCAEHRMDPVNAASFGKLIRSVFHNLKTRRLGTRGNSKYHYYGIRLKD
                     SSTLHSMQHPQPQIIQNTYTPPMQLPQRDAYADTVNQVAAIKYMDVEIPDKRARKDNS
                     SSSSSCRDSVSPCMDLPAQQTIQHTPVHSVIPSTQQPAPLHNNNVVSYVVTESDKAAM
                     GKIDLPIVPFPDKDALMATIGFRKLGVGEEELNSLIDIYEILCREILALIKNIDFASV
                     EDTWSKFWSGNFGVDRDHISALCTLDQVQDYIIEVDLALYQTIVDTLIPNVLLSELST
                     GMTQTCRTFAKNIDVYLRKSLMLANLGEFFVKKKIQAIKYLQQGLKRYTSLNHLAHAS
                     RGVLMKPEQVQQMYQDYIRVDINTVHQQAGWICGCDSVMVHHVNNAFKHNLQRMSAME
                     VWAEWLESIVDQVLAKYHDKPANVIANVGKQFLLNWSFYTSMIIRDLTLRSAMSFGSF
                     TLIRLLADDYMYYLIESKIAKAGKQQLITVIRADKDWPLTTNPQEYIVVANDNDEDLD
                     LEKAGLL"
     STS             1153..1996
                     /gene="daf-19"
                     /locus_tag="CELE_F33H1.1"
                     /standard_name="F33H1.1"
                     /db_xref="UniSTS:321430"
ORIGIN      
        1 atgaccaatg aggagccggt gccatcgacg agcagtgtgc tcagtgcagc cgagaaaaac
       61 gtgaagatag agactccttc aaggaagcga aaaggacttg atattgatgc actttggagg
      121 aagaaattta aagatgtcga aaatcaaaaa tcaccggaga aatctgaaaa gtctgaaaaa
      181 acgattaaag aagagcctct agaaacacat ccatctggag aaagaaaact tcgatctgca
      241 tccaaagatt caaaatcatt atcaaaagaa actcacaata caataagcac aaggtcttct
      301 tcgtctggaa cacctcgtaa gaaaatggag cctgaagatg tgaagccaaa tatcaagatg
      361 ctcaagaaat cattgccagt ctcatttcaa tgttctaacc taaatgatgg taccgtggga
      421 gatgcgtcag tgatgttaga tcctacaaag atatcgttgc actcgagctc agttgcctat
      481 ggagaggagt cgcaggatga aatggaggtc atccaacact cgacagacga tccgaatggc
      541 acgcgagagg aattcgacta taatcaaatt gaatatggaa acgcggttac tccaaatggc
      601 acatacactc tctatgctcc ggattcaaac tatgcgccgt actatcagta ttcaaacaac
      661 atgcagtcaa gccctcaaga caatgcacca tatttggtcc ctgctccaca gtccccggtc
      721 tcgatcgacg acgcagactc gatcaacttg ccgaacaatc aacgagcttc ccccgcaacg
      781 gtgaactggc tcttcgagaa ttacgagatt ggagaagggt cgctgccaag atgtgaactc
      841 tacgatcact acaaaaagca ttgcgctgaa catcgaatgg atccagtgaa cgctgcctca
      901 ttcggaaagc tcatccgatc cgtcttccac aacctcaaga cccgacggct gggcacccgc
      961 ggcaactcga agtaccacta ctatggcatc cgtctgaagg actcctcaac gcttcattcc
     1021 atgcagcatc cacagcctca aatcattcaa aacacataca ctccgccaat gcagctaccg
     1081 caaagagatg cgtatgctga tacggtaaac caggtggcag caatcaaata tatggatgtt
     1141 gagattccgg ataaacgagc gagaaaggac aactcatcgt cgtcatcatc ctgcagagac
     1201 agcgtctctc cttgcatgga tcttccagct caacaaacca tacagcatac ccccgtccac
     1261 tcagtcatac catcaacgca acaacctgct ccattacata acaacaatgt agtatcgtat
     1321 gtagtaactg aaagtgataa agccgcgatg ggaaagattg atcttccaat tgtgccgttt
     1381 ccggataagg atgcactgat ggctactatt ggattccgaa aacttggcgt cggagaggaa
     1441 gagctcaact ctttgattga catctacgaa atcttgtgcc gagaaattct ggctctgatc
     1501 aaaaacattg attttgcatc agtagaagac acttggagca aattttggtc cggaaacttt
     1561 ggagttgatc gagatcacat tagtgctctt tgtacactcg atcaagttca agactacatt
     1621 attgaagtgg accttgcatt gtaccaaacc atcgtcgata ctcttatccc aaacgttttg
     1681 ctctcggagc tctccacagg aatgacccag acgtgccgaa catttgctaa aaatattgat
     1741 gtgtacttga ggaaatcgct gatgctcgca aatctcggag agtttttcgt aaaaaagaag
     1801 atccaggcaa tcaagtattt gcaacaaggg ctcaaacgat acacttcttt gaatcatttg
     1861 gctcacgctt ctcgtggagt tttgatgaaa ccagagcaag ttcagcagat gtatcaagac
     1921 tatattcgag ttgatatcaa cacagtccac cagcaagccg gatggatttg tggttgcgat
     1981 agtgtcatgg tgcaccatgt gaacaacgcc ttcaagcata accttcaacg gatgagtgca
     2041 atggaggtat gggccgagtg gctggaaagt attgtggatc aagtgctcgc caagtatcac
     2101 gacaaaccgg caaacgtgat tgctaatgtc ggaaagcaat ttctgctcaa ctggagtttc
     2161 tacacatcga tgatcattcg ggatctgact ttgcgatcag ccatgtcatt cggatctttc
     2221 actctgatta ggttgctggc cgatgattac atgtattatt taattgagtc gaaaattgct
     2281 aaagccggaa aacaacaact catcacggta attcgtgccg acaaggactg gccgttgact
     2341 acaaaccctc aggaatacat agtggtagcc aatgacaatg acgaagacct tgacctcgag
     2401 aaagcaggtc ttctgtaa
//