Dbfetch

LOCUS       NM_001026921            1317 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Transcription factor lin-26 (lin-26),
            partial mRNA.
ACCESSION   NM_001026921
VERSION     NM_001026921.2
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 1317)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 1317)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1317)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 1317)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003280).
            On Jun 26, 2012 this sequence version replaced NM_001026921.1.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1317
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="II"
     gene            <1..>1317
                     /gene="lin-26"
                     /locus_tag="CELE_F18A1.2"
                     /db_xref="GeneID:3565051"
                     /db_xref="WormBase:WBGene00003012"
     CDS             1..1317
                     /gene="lin-26"
                     /locus_tag="CELE_F18A1.2"
                     /standard_name="F18A1.2a"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Transcription factor lin-26"
                     /protein_id="NP_001022092.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00003012"
                     /db_xref="EnsemblGenomes-Tr:F18A1.2a.1"
                     /db_xref="EnsemblGenomes-Tr:F18A1.2a.2"
                     /db_xref="EnsemblGenomes-Tr:F18A1.2c"
                     /db_xref="GeneID:3565051"
                     /db_xref="WormBase:WBGene00003012"
                     /translation="MLSKFVVVEVSNSNNTMTLVEYLVTHGFDKFAVVTDLVDHPSFK
                     YKDGSSSPESPSTTASTAAQHTPPRTAVSTPTSINTPVPPHQNKQRHSIDKIAANLST
                     KKVSPSSIEKQLQRTSHNPLHQLSTPHALSQLQKLLEEQHKINQMNIQKKEQERQQAE
                     IQRILLQQANAAQINHSFGLERLTPEYDDNHHSETISKASSEDLKTEPDSTDFGLGTS
                     DDQVRASMLHLLHPVFAPAFGMLDAENIFGAASKPTTPASKRRNTDSNGAPSKKHRWL
                     PVNELEESRSSRGKNCGRVHCKATYKCALCGKPTTLNSTGSRWNLLRHVIMIHSDCKP
                     YKCWDCDFTGIKSNVISHARQCRHNAEDAHDITTDEMRAEWNLRLHECFPDYVRAKER
                     GWQPEEVTVKKEEVEESPTLVKQELTLVKQEPTFAEQLEPMAQPLV"
ORIGIN      
        1 atgctttcta aatttgtggt agtcgaagta agcaactcaa ataacacaat gacactggtg
       61 gaatacttgg taacgcatgg attcgacaag tttgcagttg taacagattt agttgatcac
      121 ccttctttca agtacaagga tggttcatca agtcccgaat ctccatcaac aactgcttca
      181 actgctgccc aacacacacc accacgaaca gcagtttcaa cacctacatc catcaacact
      241 ccagttccac cacatcaaaa caaacagagg cattcaattg acaaaatcgc tgcaaattta
      301 tccaccaaaa aggtttcacc atcatctatt gagaagcagc tccaaagaac atctcataat
      361 cctcttcatc aactatctac cccacatgca ttgagtcaac tacagaaatt gctggaggag
      421 cagcacaaga ttaatcagat gaatattcag aaaaaggaac aggagaggca gcaagctgag
      481 attcaaagaa ttctgctcca acaggcaaat gctgctcaga ttaatcactc atttggatta
      541 gaaaggctaa caccagaata tgatgataat catcatagtg aaacaatatc taaagctagc
      601 tctgaagatt tgaagactga gcccgattca actgattttg ggcttggaac aagcgacgat
      661 caagtacgtg cttcaatgct tcatctgctt catccagtat ttgctccagc ttttgggatg
      721 cttgatgccg agaatatctt tggagctgca tcaaaaccaa cgacgcctgc atcaaaacga
      781 cgaaacactg attcaaatgg tgctccatcg aaaaaacatc gttggctccc agtcaatgag
      841 cttgaagaga gtcgatcatc gcgaggaaag aactgcggaa gagttcattg caaggccacc
      901 tacaagtgtg cactctgtgg aaagccaaca acactcaact caacaggatc tcgttggaat
      961 cttctgcgcc acgtcatcat gatccattcg gattgtaagc catataagtg ttgggattgt
     1021 gacttcaccg gaataaaatc caacgttatc tcccacgcca ggcaatgtcg tcacaacgcc
     1081 gaagatgccc atgacattac taccgacgag atgcgtgccg aatggaatct ccgccttcac
     1141 gaatgcttcc cagattatgt gcgtgctaaa gaacgtggat ggcaaccaga ggaggttact
     1201 gtaaagaaag aagaagtaga ggagtctcca actcttgtca aacaagaact cactcttgtt
     1261 aaacaagaac ccacttttgc cgagcaactc gagccaatgg ctcaaccatt ggtgtag
//