Dbfetch

LOCUS       NM_001026806            1683 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans Suppressor of zyg-1 protein 20 (szy-20),
            partial mRNA.
ACCESSION   NM_001026806
VERSION     NM_001026806.4
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 1683)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 1683)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1683)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 1683)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003280).
            On Jun 26, 2012 this sequence version replaced NM_001026806.3.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1683
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="II"
     gene            <1..>1683
                     /gene="szy-20"
                     /locus_tag="CELE_C18E9.3"
                     /db_xref="GeneID:174430"
                     /db_xref="WormBase:WBGene00004105"
     CDS             1..1683
                     /gene="szy-20"
                     /locus_tag="CELE_C18E9.3"
                     /standard_name="C18E9.3c"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="Suppressor of zyg-1 protein 20"
                     /protein_id="NP_001021977.2"
                     /db_xref="EnsemblGenomes-Gn:WBGene00004105"
                     /db_xref="EnsemblGenomes-Tr:C18E9.3c.1"
                     /db_xref="EnsemblGenomes-Tr:C18E9.3c.2"
                     /db_xref="GeneID:174430"
                     /db_xref="GOA:Q565A8"
                     /db_xref="InterPro:IPR024771"
                     /db_xref="UniProtKB/TrEMBL:Q565A8"
                     /db_xref="WormBase:WBGene00004105"
                     /translation="MSKENVVADSWDDADADPVKELMDKVEKVKLLQRKEEKKEAFFE
                     KVKAEESSGVVSKLQTEEGLGPSAEEPKRVFLRRPKDGFAASENVIEASPPTSADTEE
                     QPVTNVRSRSHHKLNQKEKQPAPTYEERQAAYQAARNRILGTEYKPDNQEIKEIKFID
                     RSKSPETLKMTQQNMVEHYGEELSRELMEQPAEIVPPERQYTPDFTLQQPPPSVSESG
                     GVYNGPPGFQQKQPNFQPTLQQQSLHQQQYLDNQYMMQMNVQIPIQYHNQTQHQFVPH
                     EASAISTTSQNSNGDGQNDQAIYYYQAPTQQPMNYIPYNLPNMAYPPPNFQPQGQLHH
                     QMNAGQLHQIQQQQQQCQQIQHQPPQQHQQVINGQVMNQQNQRNQVNSYPQQNGAGRG
                     QNRQPMMYQMPCNSGPTAKPPPLMNQMQNRCMTNNGQNYQNRNMQQQGQQRSYSSQPQ
                     NGQFYQNGNSNQNNPNNGRKQQHQPQQQQNKSGKFGQNRNDMQKNNYQPNLQQPPMSQ
                     NPIPFGCPPRNVNAIREQHANNGSPNTGAGILGPHPMMSASQWPALQQNRPQ"
ORIGIN      
        1 atgagtaaag aaaatgttgt cgccgatagc tgggatgatg cagatgcgga tccagtcaag
       61 gaattaatgg ataaggttga gaaggtaaaa cttcttcagc ggaaggaaga aaagaaggaa
      121 gcattttttg agaaagtaaa agcagaagag agtagcggtg tcgtttcgaa actccagaca
      181 gaagaaggtc tcggaccatc agctgaagag cctaaacgag tgttccttcg gcgccctaaa
      241 gatggttttg ctgcatctga aaatgtcatc gaagcatcgc caccaacatc tgcagataca
      301 gaagaacagc cagtgacaaa cgtccgatct cgctctcacc acaaattaaa tcaaaaggaa
      361 aaacaacctg ctcctactta tgaggaacga caagctgcat accaagcagc tcgtaacaga
      421 attttgggaa ccgagtacaa acccgataat caggaaatca aagaaatcaa gtttattgat
      481 cgctccaaat cacctgaaac tctcaaaatg actcaacaaa acatggtaga gcactatgga
      541 gaggaattga gccgcgaatt aatggagcag ccagctgaaa ttgtccctcc tgaacggcaa
      601 tatactccag attttacgct tcagcagcca ccaccatcgg tatcggagag cggcggagtt
      661 tacaatggac cgcctgggtt tcaacagaag caaccaaatt tccagccaac gttacaacaa
      721 caatcgcttc atcaacaaca gtatttggat aatcagtata tgatgcagat gaacgtacaa
      781 attccgatac agtatcataa tcagacccaa catcagtttg ttccgcatga agcctcagct
      841 atttccacaa catcacaaaa cagcaacggt gatggtcaaa atgatcaagc gatatattat
      901 tatcaggcgc ctacccaaca gccaatgaac tacattccgt acaatctacc aaacatggcc
      961 tacccacctc caaacttcca accccaagga caactgcacc atcaaatgaa tgcaggacaa
     1021 ctacaccaaa ttcaacaaca acagcaacaa tgccaacaga ttcaacatca accgcctcag
     1081 caacaccaac aggttataaa tggccaagtg atgaatcaac agaaccaaag aaatcaggtg
     1141 aatagttatc cacagcagaa tggtgctggt cgtggacaga atcgacagcc gatgatgtat
     1201 cagatgccat gcaacagtgg gccgacagca aagcccccgc cgttgatgaa tcaaatgcag
     1261 aatagatgta tgaccaacaa tggtcaaaac tatcagaata ggaatatgca gcagcaaggt
     1321 cagcagcgat catattcgtc acagcctcag aatggtcagt tctaccaaaa cggaaattcc
     1381 aaccagaaca atccgaataa tggtagaaaa cagcagcatc agccacagca gcagcagaac
     1441 aaatcaggaa aattcggaca gaatagaaat gatatgcaaa agaacaatta tcaaccaaat
     1501 ctacagcaac ctccgatgag tcaaaatcca attccatttg gatgcccacc acgtaatgtg
     1561 aatgcgattc gagaacaaca cgcaaacaat ggatccccaa acactggcgc tggaattctt
     1621 ggaccacatc caatgatgtc tgcatcccaa tggccagcgt tgcagcagaa tcggcctcaa
     1681 tag
//