Dbfetch

LOCUS       NM_001025838            1542 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans PolyBRoMo domain containing (pbrm-1),
            partial mRNA.
ACCESSION   NM_001025838
VERSION     NM_001025838.2
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 1542)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 1542)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1542)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 1542)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003279).
            On Jun 26, 2012 this sequence version replaced NM_001025838.1.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1542
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="I"
     gene            <1..>1542
                     /gene="pbrm-1"
                     /locus_tag="CELE_C26C6.1"
                     /db_xref="GeneID:172504"
                     /db_xref="WormBase:WBGene00007042"
     CDS             1..1542
                     /gene="pbrm-1"
                     /locus_tag="CELE_C26C6.1"
                     /standard_name="C26C6.1b"
                     /note="Product from WormBase gene class pbrm;
                     Confirmed by transcript evidence"
                     /codon_start=1
                     /product="PolyBRoMo domain containing"
                     /protein_id="NP_001021009.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00007042"
                     /db_xref="EnsemblGenomes-Tr:C26C6.1b.1"
                     /db_xref="EnsemblGenomes-Tr:C26C6.1b.2"
                     /db_xref="GeneID:172504"
                     /db_xref="GOA:Q565A2"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR027180"
                     /db_xref="InterPro:IPR036910"
                     /db_xref="InterPro:IPR037382"
                     /db_xref="UniProtKB/TrEMBL:Q565A2"
                     /db_xref="WormBase:WBGene00007042"
                     /translation="MDKELSPLLKGEGVMPLDHLDEMMDDDTDGSESVSSSIHPKILK
                     EGSPPATVQSQTSSVSTPPQHPSISAEMPIMTPKAVKSKSGYILFSAEVRKRIMHENP
                     DAGFGEVSKIVGIEWKKLSEEQKKHYEMRAEVVAVEKAKQDAIKASQAMTLLPGQVRI
                     YQCKWAACDSQYDTESALLEHVIQHHTSQIIMDSDQQFVCMWMTCLRNRKDGKPFPSL
                     PRLHRHIKEKHMPTAAKNIYSNQLGKNFFKSIPNQGDTPGCRIVSAPYGQLPTAPSNG
                     GIPPQQQHQQQQHHGNGMNGNMQQGAPQVINRHPVSQQMHHQHPQHMQQHHDHHPHQQ
                     HYQQGGQPHPQMQMGPPQNGMFQQGSSSSQQYHQAPPQQMIQQQHQQPGPPPQQQQPQ
                     MQPIVVTDVGRTVVRAVVPAFVAPPNQIHSRRVLHSEAYLKYIESLAQNRQKSVSRWE
                     RTLGATARNTQPAGNARAPSHWIRRIENGRPVAREEDVTKALWKLRDELLKSTCSLVM
                     DRPTQ"
ORIGIN      
        1 atggacaaag aactctcacc actattgaaa ggcgaaggcg ttatgccact ggatcatctg
       61 gacgaaatga tggacgacga tacggatgga agtgaatcgg tgtcaagcag tattcatccg
      121 aagatcctga aagaaggatc acccccagct acagttcaat cgcagacttc ttcagtttca
      181 acacctccac aacatcccag tatatcagca gaaatgccta ttatgacacc aaaagcagtt
      241 aagagcaaga gtggatacat tttgttctct gctgaagttc gtaagaggat aatgcatgaa
      301 aatccagacg caggattcgg tgaagtttcc aagatagttg gtattgagtg gaaaaaattg
      361 tcggaagaac aaaagaagca ttacgagatg cgtgcggaag tcgtcgctgt tgagaaagcc
      421 aaacaggatg ccattaaagc atcgcaagcg atgacccttt tgcccggaca agtgaggata
      481 tatcagtgta aatgggctgc ttgtgattca caatatgata ccgaatcggc ccttctggag
      541 catgttatcc aacatcatac tagtcaaatt attatggaca gtgaccagca attcgtatgt
      601 atgtggatga cgtgtctacg taatcgaaaa gacggaaaac cattcccatc gcttcctcga
      661 cttcaccgtc acattaaaga aaaacatatg cctacggcgg cgaaaaacat ttactccaac
      721 cagctaggca agaatttttt taagtcgata ccaaatcaag gagacactcc tggatgccgt
      781 atagtatctg cgccttacgg acaattacca actgcaccat caaatggtgg aattccccct
      841 caacaacaac atcaacaaca gcagcatcat ggaaatggaa tgaacggaaa tatgcaacaa
      901 ggcgctccac aagttataaa caggcatcct gttagccaac aaatgcatca tcagcatcca
      961 cagcatatgc agcaacatca cgatcatcat ccacatcagc agcattatca gcaaggtggc
     1021 caacctcatc cacagatgca aatgggacca ccacaaaacg gaatgttcca acaaggatct
     1081 tcttcatctc aacaatatca tcaggcacca cctcaacaaa tgattcaaca acaacatcaa
     1141 caacctggtc cacctccaca acagcaacaa ccacaaatgc aacctatcgt ggttacagat
     1201 gttggacgaa ctgtagttcg agcagttgta cctgcatttg ttgcaccacc gaatcaaatt
     1261 cattcgagaa gagttctaca ttcggaagca tatctcaagt atatcgaatc acttgcccag
     1321 aatcgacaga agtcggtaag ccgatgggaa cgaactctag gagcaactgc caggaatacc
     1381 caaccagctg gaaatgcccg cgctccatct cattggataa ggagaattga aaacggacga
     1441 cctgtagctc gcgaagagga tgttacaaaa gctttgtgga aacttcgcga tgaattgttg
     1501 aagagtacgt gtagtcttgt aatggaccga ccaactcaat ga
//