Dbfetch

LOCUS       NM_001025837            5652 bp    mRNA    linear   INV 09-APR-2019
DEFINITION  Caenorhabditis elegans PolyBRoMo domain containing (pbrm-1),
            partial mRNA.
ACCESSION   NM_001025837
VERSION     NM_001025837.3
DBLINK      BioProject: PRJNA158
            BioSample: SAMEA3138177
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 5652)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 5652)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 5652)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2019) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 5652)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003279).
            On Jun 26, 2012 this sequence version replaced NM_001025837.2.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..5652
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="I"
     gene            <1..>5652
                     /gene="pbrm-1"
                     /locus_tag="CELE_C26C6.1"
                     /db_xref="GeneID:172504"
                     /db_xref="WormBase:WBGene00007042"
     CDS             1..5652
                     /gene="pbrm-1"
                     /locus_tag="CELE_C26C6.1"
                     /standard_name="C26C6.1a"
                     /note="Confirmed by transcript evidence;
                     Product from WormBase gene class pbrm"
                     /codon_start=1
                     /product="PolyBRoMo domain containing"
                     /protein_id="NP_001021008.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00007042"
                     /db_xref="EnsemblGenomes-Tr:C26C6.1a"
                     /db_xref="GeneID:172504"
                     /db_xref="GOA:G5EEY5"
                     /db_xref="InterPro:IPR001025"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR027180"
                     /db_xref="InterPro:IPR036427"
                     /db_xref="InterPro:IPR036910"
                     /db_xref="InterPro:IPR037382"
                     /db_xref="InterPro:IPR037968"
                     /db_xref="UniProtKB/TrEMBL:G5EEY5"
                     /db_xref="WormBase:WBGene00007042"
                     /translation="MSTKRKRAAEPDPEKDVASTSTASKKRKGRMTIAEKEKREFEMA
                     KGNYVMAQIRKHRSSAGNNSVFESFLRLPPRRFEPEYYEQVKEPIDVTTIQHKLKIPE
                     YLTYDQFNDDFMMFIKNNLTYYKDESEEHKDMMKIQELFEAATAKVKSGEYLDDAEDE
                     EGDEDVEETVQEEEEPEESGTSSRDSTPMDLDHFMLCDLLGAVLEATDNTGRLLCPPF
                     RVLQSREDFPLYYEKIAKPIDLKTIAQNGVNKKYSTMKELKDDLFLLFKNAQQFSGNG
                     SDIFKDAEQLKTVVKEKIARLEEKGVHPMRRAKATRLVDALLTAVAVNENFSEDSEED
                     EETETNSEPMWKLYWTIRNAVHEKDRNVTLADNFLELPSKESYPDYYDEIKNPVSIFM
                     INKRLKNGKYDLKSLVADLMQMYSNAFDYNLESSEVYISAEKLKALTISTCKQLVPSF
                     DVSQYEPAPAQLTPVKPKATPHRARIKIEMPDTDSEDSRTPPPTHKRKSPKKPRENGS
                     VPTPTFKGRKSTIPVDPNAAYMKQKAMMQGLWNVIHSYRVASNPGHWPAGAFIQLPSA
                     KQYPEYYQIIQNPIDMKTIRMRIDGHQYPQVDAMINDCRVMFSNARDFNEPRSMIHMD
                     AIQLEKAVLRAYEGMRNTSLGSSIPSTPHSSSSNLMKAMKLKTPKSEVRGRGKKNFSG
                     SDDEESARINIQQHQRSMEDAIMQLPIEEQKMWRLFKSMKDVREEGTNRPLAVNFMRL
                     PSKEEFPAYYDVIKKPMDMMRIKHKLENRQYVTLLDVVSDFMLMLSNACKFNETDSDI
                     YKEAVSLQKALLEMKRELDTGDDAPRVQVELRTIFTSIFASLFSKKDEEGKCYSDHLT
                     EFTEVLKANGVPSSEWPFTLDQIKMNIDKCRYRRLDKLQKDFFDLFERARELSKAGSS
                     MYEAACTLQKSFIVERDTRCKDLIHSNAYCVIEKDIDEAIEKERSLKAKEEHDEEGGN
                     KPAMVKRHESEVEMEDIEIDGTKYVAPCYAYVSRSDEKKTPLHIFRIERTFKDENGEK
                     ALQGHWVYRPEETLHLASRKFMKQEVFLTPFRDTVLAERLRGRCVVISLSTYTSKVIT
                     EYSEEDVYLCEYKYHGKPKYFAKLRTWPFTAEDEELEYTKRTKLMTPKRNLTAVDSDG
                     NEGKDDVIVDGEEEEDEEDRARLEVSLDMERFELEASKDEESGKTYFQQIRSETGKFF
                     WLGQCVLVFNNMKPLCDVMKINKIWREKDGSEWFSGCWFARPSETIHDEGRLFFKNEV
                     IAVYRNDETRKLCEIQRVCDVMPAKLYIKQRQTEVSECDVFVCETMVNGSADTPDDCS
                     LFGFQSIVDEFSDAQTMNLDYGKAMRKMKAHKLHVSIPNEEVLFYKQPIKMDKELSPL
                     LKGEGVMPLDHLDEMMDDDTDGSESVSSSIHPKILKEGSPPATVQSQTSSVSTPPQHP
                     SISAEMPIMTPKAVKSKSGYILFSAEVRKRIMHENPDAGFGEVSKIVGIEWKKLSEEQ
                     KKHYEMRAEVVAVEKAKQDAIKASQAMTLLPGQVRIYQCKWAACDSQYDTESALLEHV
                     IQHHTSQIIMDSDQQFVCMWMTCLRNRKDGKPFPSLPRLHRHIKEKHMPTAAKNIYSN
                     QLGKNFFKSIPNQGDTPGCRIVSAPYGQLPTAPSNGGIPPQQQHQQQQHHGNGMNGNM
                     QQGAPQVINRHPVSQQMHHQHPQHMQQHHDHHPHQQHYQQGGQPHPQMQMGPPQNGMF
                     QQGSSSSQQYHQAPPQQMIQQQHQQPGPPPQQQQPQMQPIVVTDVGRTVVRAVVPAFV
                     APPNQIHSRRVLHSEAYLKYIESLAQNRQKSVSRWERTLGATARNTQPAGNARAPSHW
                     IRRIENGRPVAREEDVTKALWKLRDELLKSTCSLVMDRPTQ"
     STS             1623..2681
                     /gene="pbrm-1"
                     /locus_tag="CELE_C26C6.1"
                     /standard_name="C26C6.1"
                     /db_xref="UniSTS:306043"
ORIGIN      
        1 atgagtacga aaagaaagcg tgctgccgag cccgacccgg aaaaggatgt tgcttccact
       61 tctaccgctt ccaagaagcg gaaaggacga atgacaattg cggaaaagga aaagcgagag
      121 tttgagatgg cgaagggtaa ttatgtgatg gcacagattc gaaaacatcg aagttccgcc
      181 ggcaataatt ctgtattcga gagttttctc cgattaccgc cacgccgctt cgagcctgaa
      241 tattatgagc aagtaaaaga gccgattgat gttaccacaa tccaacataa actgaaaatt
      301 cccgaatatt tgacgtatga tcagtttaat gatgatttca tgatgttcat taaaaacaac
      361 ctcacttact acaaagacga atctgaagaa cacaaggata tgatgaaaat tcaagaactt
      421 ttcgaggctg ctaccgctaa ggtgaaatct ggagaatatc tagatgacgc agaggacgaa
      481 gagggagacg aagatgtgga agagacagtt caggaagagg aagaacctga agagagtgga
      541 acatcatctc gtgattcgac acctatggac ctggatcact tcatgctttg tgatcttttg
      601 ggagcggttc ttgaagcgac tgataacacc ggaaggcttc tttgcccacc attccgagtt
      661 cttcaaagtc gagaagattt cccattgtac tatgagaaaa tagctaaacc aattgatctc
      721 aaaacgattg ctcaaaacgg agtgaacaag aagtattcca caatgaaaga actcaaagat
      781 gatctattcc tgctcttcaa aaatgcacag cagtttagtg gaaacggtag tgatattttc
      841 aaagatgctg aacaattgaa aactgttgtg aaagaaaaga ttgctcgatt ggaagagaag
      901 ggagttcatc caatgagaag agccaaagcc acacgactcg ttgatgcttt gttaaccgct
      961 gttgcagtta atgaaaactt ctcagaagat tcagaagagg acgaagaaac tgaaacaaat
     1021 tcggagccta tgtggaagtt gtattggaca atcagaaatg ctgttcacga gaaagatcga
     1081 aatgttacgc tggctgacaa ctttttggaa cttccaagca aagaatctta ccccgactac
     1141 tatgatgaga tcaaaaaccc tgtgtcaatt ttcatgataa ataaaagatt gaaaaatggg
     1201 aaatatgatt tgaaatctct cgtcgctgat ctcatgcaaa tgtattcaaa tgctttcgac
     1261 tacaatcttg aatcatcaga agtctacatt tctgcggaaa agctgaaggc actaacgata
     1321 tccacgtgca agcaacttgt tccttcattc gatgtttctc aatacgaacc tgctccggca
     1381 caacttacac cagtgaaacc aaaagcgaca ccacacagag ctcgaattaa gattgagatg
     1441 ccggacacag actcggaaga tagtaggact ccacctccta ctcataaaag gaaatctccg
     1501 aaaaaacctc gtgaaaatgg aagtgttcct actccaactt ttaaaggcag aaaatcgacg
     1561 atccctgtcg atccaaatgc tgcttatatg aagcaaaaag caatgatgca agggctttgg
     1621 aacgttatcc attcctacag agtcgcttcg aatccgggac attggccagc gggagcattc
     1681 atacaattgc catctgccaa acaatatcca gaatactatc aaattattca aaatccgatt
     1741 gatatgaaaa cgattcggat gagaatagat ggacatcagt atccacaggt tgatgcaatg
     1801 atcaacgatt gtcgagtgat gttttcgaat gctagagatt tcaatgaacc ccgttcaatg
     1861 atacacatgg atgctattca actagagaaa gcagttttgc gagcttatga aggaatgaga
     1921 aacacgtcac tgggctcttc aataccgtca actcctcatt cgtcatcgtc aaatcttatg
     1981 aaagcaatga aactaaaaac tccgaaatcc gaggtccgtg gtcgcggtaa aaagaacttt
     2041 agtggatctg atgatgagga atcagctcga attaacatac aacaacatca aagaagcatg
     2101 gaggatgcta taatgcagct tccaatcgaa gagcaaaaaa tgtggagatt gttcaaatct
     2161 atgaaagatg ttcgtgagga aggaaccaac cgtccattgg ctgtaaactt catgcgtctt
     2221 ccatcaaagg aggaatttcc tgcatattat gacgtcatta aaaagccgat ggatatgatg
     2281 aggatcaagc ataagctgga gaatcgtcag tatgtaacac tgcttgatgt ggtttctgat
     2341 ttcatgctaa tgctttctaa tgcctgcaaa ttcaatgaga ctgattctga catctacaag
     2401 gaagcagttt ctcttcagaa ggcacttttg gaaatgaagc gagagcttga taccggagat
     2461 gatgcaccaa gagttcaggt tgaattgaga accatattta cttcaatatt tgcctcgctg
     2521 ttcagtaaga aagatgaaga aggaaaatgt tattcggatc atttaactga atttacggaa
     2581 gttctcaaag cgaatggagt accttcatct gaatggccat tcactcttga tcaaattaag
     2641 atgaatatag ataaatgccg ttacagacga ctcgataagc ttcaaaagga ctttttcgat
     2701 ctgttcgaaa gagcaagaga actctcaaaa gcaggctctt caatgtacga agcagcatgt
     2761 acacttcaaa aatcatttat tgttgaacgt gatacacgat gcaaagattt gatacactca
     2821 aatgcgtact gtgtaattga aaaagatatt gatgaagcta ttgaaaagga aagaagcttg
     2881 aaggcaaaag aagaacatga tgaggaggga ggaaacaaac cggcgatggt gaaaagacat
     2941 gaaagcgaag tcgaaatgga agatattgaa atcgatggaa cgaaatatgt ggcaccatgt
     3001 tacgcatacg tttcccgatc tgacgagaag aaaactcctc ttcacatttt ccgaattgaa
     3061 cgaactttta aagacgagaa tggggaaaaa gctcttcaag gacattgggt ttaccgtcct
     3121 gaagaaactc ttcatttggc aagccgaaag ttcatgaaac aagaagtttt tcttacgcct
     3181 ttccgagata cagtacttgc tgaacgtcta cgaggacgat gtgtcgtcat ttcactttcc
     3241 acgtacactt caaaagtaat caccgagtac agtgaagaag atgtatatct ctgtgagtac
     3301 aagtatcatg gaaaaccaaa atactttgct aagctgagaa cctggccatt cactgctgaa
     3361 gacgaggaat tggagtatac aaagagaaca aaactaatga ctcctaaacg gaatttgaca
     3421 gcagttgatt ctgatggaaa cgaaggaaaa gacgatgtaa ttgttgatgg agaagaagaa
     3481 gaagatgaag aagatcgtgc tcgtcttgaa gtatcattgg atatggaaag atttgagttg
     3541 gaagcgtcaa aagatgaaga atctggaaaa acatacttcc aacaaatccg ttctgaaact
     3601 ggaaagtttt tctggctcgg acaatgtgtt ctggtgttta acaatatgaa gccgttgtgt
     3661 gatgtgatga agattaataa gatttggaga gaaaaagacg gttctgagtg gttttccggc
     3721 tgctggtttg ctcgtccatc tgaaacaatt cacgacgagg gacgactttt cttcaagaat
     3781 gaggttattg cggtgtatcg aaacgacgaa actcgtaaat tgtgcgagat tcagagagtt
     3841 tgtgacgtta tgcctgctaa gctgtatata aaacagcgac agactgaagt atcggaatgt
     3901 gatgtttttg tttgtgaaac aatggtcaac ggatcagcag atacacctga cgattgttct
     3961 ttgtttggtt ttcagagtat tgtcgatgag ttcagtgatg ctcaaacaat gaatctcgat
     4021 tatggaaagg caatgcgtaa gatgaaggct cacaaacttc acgtttcaat cccgaatgaa
     4081 gaagtgctgt tttacaaaca accaataaaa atggacaaag aactctcacc actattgaaa
     4141 ggcgaaggcg ttatgccact ggatcatctg gacgaaatga tggacgacga tacggatgga
     4201 agtgaatcgg tgtcaagcag tattcatccg aagatcctga aagaaggatc acccccagct
     4261 acagttcaat cgcagacttc ttcagtttca acacctccac aacatcccag tatatcagca
     4321 gaaatgccta ttatgacacc aaaagcagtt aagagcaaga gtggatacat tttgttctct
     4381 gctgaagttc gtaagaggat aatgcatgaa aatccagacg caggattcgg tgaagtttcc
     4441 aagatagttg gtattgagtg gaaaaaattg tcggaagaac aaaagaagca ttacgagatg
     4501 cgtgcggaag tcgtcgctgt tgagaaagcc aaacaggatg ccattaaagc atcgcaagcg
     4561 atgacccttt tgcccggaca agtgaggata tatcagtgta aatgggctgc ttgtgattca
     4621 caatatgata ccgaatcggc ccttctggag catgttatcc aacatcatac tagtcaaatt
     4681 attatggaca gtgaccagca attcgtatgt atgtggatga cgtgtctacg taatcgaaaa
     4741 gacggaaaac cattcccatc gcttcctcga cttcaccgtc acattaaaga aaaacatatg
     4801 cctacggcgg cgaaaaacat ttactccaac cagctaggca agaatttttt taagtcgata
     4861 ccaaatcaag gagacactcc tggatgccgt atagtatctg cgccttacgg acaattacca
     4921 actgcaccat caaatggtgg aattccccct caacaacaac atcaacaaca gcagcatcat
     4981 ggaaatggaa tgaacggaaa tatgcaacaa ggcgctccac aagttataaa caggcatcct
     5041 gttagccaac aaatgcatca tcagcatcca cagcatatgc agcaacatca cgatcatcat
     5101 ccacatcagc agcattatca gcaaggtggc caacctcatc cacagatgca aatgggacca
     5161 ccacaaaacg gaatgttcca acaaggatct tcttcatctc aacaatatca tcaggcacca
     5221 cctcaacaaa tgattcaaca acaacatcaa caacctggtc cacctccaca acagcaacaa
     5281 ccacaaatgc aacctatcgt ggttacagat gttggacgaa ctgtagttcg agcagttgta
     5341 cctgcatttg ttgcaccacc gaatcaaatt cattcgagaa gagttctaca ttcggaagca
     5401 tatctcaagt atatcgaatc acttgcccag aatcgacaga agtcggtaag ccgatgggaa
     5461 cgaactctag gagcaactgc caggaatacc caaccagctg gaaatgcccg cgctccatct
     5521 cattggataa ggagaattga aaacggacga cctgtagctc gcgaagagga tgttacaaaa
     5581 gctttgtgga aacttcgcga tgaattgttg aagagtacgt gtagtcttgt aatggaccga
     5641 ccaactcaat ga
//