Dbfetch

LOCUS       XM_308891                552 bp    mRNA    linear   INV 28-SEP-2011
DEFINITION  Anopheles gambiae str. PEST AGAP006864-PA (CPR34) mRNA, complete
            cds.
ACCESSION   XM_308891
VERSION     XM_308891.2
KEYWORDS    RefSeq.
SOURCE      Anopheles gambiae str. PEST
  ORGANISM  Anopheles gambiae str. PEST
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Holometabola; Diptera; Nematocera; Culicoidea;
            Culicidae; Anophelinae; Anopheles.
REFERENCE   1  (bases 1 to 552)
  AUTHORS   Mongin,E., Louis,C., Holt,R.A., Birney,E. and Collins,F.H.
  TITLE     The Anopheles gambiae genome: an update
  JOURNAL   Trends Parasitol. 20 (2), 49-52 (2004)
   PUBMED   14747013
REFERENCE   2  (bases 1 to 552)
  AUTHORS   Holt,R.A., Subramanian,G.M., Halpern,A., Sutton,G.G., Charlab,R.,
            Nusskern,D.R., Wincker,P., Clark,A.G., Ribeiro,J.M., Wides,R.,
            Salzberg,S.L., Loftus,B., Yandell,M., Majoros,W.H., Rusch,D.B.,
            Lai,Z., Kraft,C.L., Abril,J.F., Anthouard,V., Arensburger,P.,
            Atkinson,P.W., Baden,H., de Berardinis,V., Baldwin,D., Benes,V.,
            Biedler,J., Blass,C., Bolanos,R., Boscus,D., Barnstead,M., Cai,S.,
            Center,A., Chaturverdi,K., Christophides,G.K., Chrystal,M.A.,
            Clamp,M., Cravchik,A., Curwen,V., Dana,A., Delcher,A., Dew,I.,
            Evans,C.A., Flanigan,M., Grundschober-Freimoser,A., Friedli,L.,
            Gu,Z., Guan,P., Guigo,R., Hillenmeyer,M.E., Hladun,S.L.,
            Hogan,J.R., Hong,Y.S., Hoover,J., Jaillon,O., Ke,Z., Kodira,C.,
            Kokoza,E., Koutsos,A., Letunic,I., Levitsky,A., Liang,Y., Lin,J.J.,
            Lobo,N.F., Lopez,J.R., Malek,J.A., McIntosh,T.C., Meister,S.,
            Miller,J., Mobarry,C., Mongin,E., Murphy,S.D., O'Brochta,D.A.,
            Pfannkoch,C., Qi,R., Regier,M.A., Remington,K., Shao,H.,
            Sharakhova,M.V., Sitter,C.D., Shetty,J., Smith,T.J., Strong,R.,
            Sun,J., Thomasova,D., Ton,L.Q., Topalis,P., Tu,Z., Unger,M.F.,
            Walenz,B., Wang,A., Wang,J., Wang,M., Wang,X., Woodford,K.J.,
            Wortman,J.R., Wu,M., Yao,A., Zdobnov,E.M., Zhang,H., Zhao,Q.,
            Zhao,S., Zhu,S.C., Zhimulev,I., Coluzzi,M., della Torre,A.,
            Roth,C.W., Louis,C., Kalush,F., Mural,R.J., Myers,E.W., Adams,M.D.,
            Smith,H.O., Broder,S., Gardner,M.J., Fraser,C.M., Birney,E.,
            Bork,P., Brey,P.T., Venter,J.C., Weissenbach,J., Kafatos,F.C.,
            Collins,F.H. and Hoffman,S.L.
  TITLE     The genome sequence of the malaria mosquito Anopheles gambiae
  JOURNAL   Science 298 (5591), 129-149 (2002)
   PUBMED   12364791
REFERENCE   3  (bases 1 to 552)
  CONSRTM   VectorBase
  TITLE     Anopheles gambiae revised assembly AgamP3 and re-annotation
  JOURNAL   Unpublished
REFERENCE   4  (bases 1 to 552)
  CONSRTM   VectorBase
  TITLE     Direct Submission
  JOURNAL   Submitted (31-JUL-2006) VectorBase / Ensembl, European
            Bioinformatics Institute, Wellcome Trust Genome Campus, Hinxton,
            Cambridge CB10 1SD, UK
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NT_078265).
            On Feb 1, 2005 this sequence version replaced gi:31199886.
FEATURES             Location/Qualifiers
     source          1..552
                     /organism="Anopheles gambiae str. PEST"
                     /mol_type="mRNA"
                     /strain="PEST"
                     /db_xref="taxon:180454"
                     /chromosome="2L"
     gene            1..552
                     /gene="CPR34"
                     /locus_tag="AgaP_AGAP006864"
                     /old_locus_tag="AgaP_ENSANGG00000020866"
                     /old_locus_tag="ENSANGG00000020866"
                     /db_xref="GeneID:1270212"
                     /db_xref="VectorBase:AGAP006864"
     CDS             52..465
                     /gene="CPR34"
                     /locus_tag="AgaP_AGAP006864"
                     /old_locus_tag="AgaP_ENSANGG00000020866"
                     /old_locus_tag="ENSANGG00000020866"
                     /note="AGAP006864-PA encoded by AGAP006864-RA"
                     /codon_start=1
                     /product="AGAP006864-PA"
                     /protein_id="XP_308891.2"
                     /db_xref="VectorBase:AGAP006864-PA"
                     /db_xref="GeneID:1270212"
                     /db_xref="VectorBase:AGAP006864"
                     /translation="MFKIIALTVACLAVAASAQYWGGSGYGYGAEHHGHHDYYSHPSY
                     KFEYGVKDPHTGDHKSQWEHRDGDVVKGAYTLHEADGTERVVEYSSDKHNGFQAHVKR
                     VGHAHHPQVYGHHGGYYGGYGHGSGYSYSKLDQHF"
ORIGIN      
        1 tcttgccaac agtagccaaa gccaactaac caaatcactt ctttagcaaa gatgttcaag
       61 atcatcgcac tgactgtcgc ctgtttggct gtagctgctt cggctcaata ctggggcgga
      121 tctggatatg gatacggtgc ggagcatcat ggccatcacg attactattc acatcctagt
      181 tacaagttcg agtacggtgt gaaggatcct cacaccggag accacaagag ccagtgggaa
      241 catcgcgacg gagatgtcgt caagggagcg tacaccctgc acgaggccga cggaactgaa
      301 cgagtggttg agtactcgtc cgacaagcac aacggcttcc aagctcatgt gaagcgagtg
      361 ggtcatgctc atcatcctca agtgtatgga catcacggag gatactatgg aggatacggt
      421 catggctcgg gctacagcta cagcaagttg gaccagcatt tctaagttat tgttgatttt
      481 gctaaatcag aatcggcgct atgtgtttgg ttgattgttc ctgaataaat ccattgttaa
      541 cgttgcatac gt
//