Dbfetch

Dbfetch

LOCUS       XM_012207059             561 bp    mRNA    linear   INV 02-APR-2015
DEFINITION  PREDICTED: Atta cephalotes uncharacterized LOC105625738
            (LOC105625738), mRNA.
ACCESSION   XM_012207059
VERSION     XM_012207059.1
DBLINK      BioProject: PRJNA279976
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Atta cephalotes
  ORGANISM  Atta cephalotes
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
            Aculeata; Formicoidea; Formicidae; Myrmicinae; Atta.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_012130067.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Atta cephalotes Annotation Release
                                           100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 35% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..561
                     /organism="Atta cephalotes"
                     /mol_type="mRNA"
                     /db_xref="taxon:12957"
                     /chromosome="Unknown"
                     /sex="male"
     gene            1..561
                     /gene="LOC105625738"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins"
                     /db_xref="GeneID:105625738"
     CDS             1..561
                     /gene="LOC105625738"
                     /codon_start=1
                     /product="uncharacterized protein LOC105625738"
                     /protein_id="XP_012062449.1"
                     /db_xref="GeneID:105625738"
                     /translation="MKSAGWTSRQREPVKFFESWAMKEGEDKRKRERRKSVGDGGAES
                     ERRSRRWSVEDGCAPSRLRVTLWKGRLYPAYSLSGSEGEDNTSSLRSRAYPQNNPTNQ
                     SHHNHYNTSQHKQRAYQQQQQHPLYHMPGSGAGLSDTPTSGNASDETLTDSDLITVAR
                     DSALLVHNGEYDNNSCKYSYGKFVSL"
ORIGIN      
        1 atgaagtctg cagggtggac gtcgaggcag agggagccag taaaattctt cgagtcatgg
       61 gcgatgaaag aaggagaaga caagagaaag agggaaagga ggaaaagcgt cggggatggt
      121 ggtgcggaaa gtgaaagaag gagcagaaga tggagtgtcg aggacggttg tgcaccgtcg
      181 cgactgaggg tgactctgtg gaagggacgg ctttatccgg cctacagtct aagtggcagc
      241 gagggtgagg ataatacctc cagtttacgt agtcgagcct atccacaaaa taatccaacc
      301 aaccaatccc atcataatca ttacaacacg agtcaacaca aacagcgtgc atatcaacag
      361 caacaacaac atcctctata tcatatgccc ggcagtggtg ccggtctcag tgacacaccg
      421 acttccggta acgcatctga cgaaactctc actgatagtg accttatcac tgttgctcgc
      481 gattctgcgc tgctcgtcca taacggtgag tacgacaata attcttgtaa atattcatac
      541 ggtaagtttg tatctctgtg a
//