Dbfetch
LOCUS XM_012207059 561 bp mRNA linear INV 02-APR-2015
DEFINITION PREDICTED: Atta cephalotes uncharacterized LOC105625738
(LOC105625738), mRNA.
ACCESSION XM_012207059
VERSION XM_012207059.1
DBLINK BioProject: PRJNA279976
KEYWORDS RefSeq; includes ab initio.
SOURCE Atta cephalotes
ORGANISM Atta cephalotes
Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
Aculeata; Formicoidea; Formicidae; Myrmicinae; Atta.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NW_012130067.1) annotated using gene prediction method: Gnomon.
Also see:
Documentation of NCBI's Annotation Process
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI
Annotation Status :: Full annotation
Annotation Version :: Atta cephalotes Annotation Release
100
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 6.2
Annotation Method :: Best-placed RefSeq; Gnomon
Features Annotated :: Gene; mRNA; CDS; ncRNA
##Genome-Annotation-Data-END##
##RefSeq-Attributes-START##
ab initio :: 35% of CDS bases
##RefSeq-Attributes-END##
FEATURES Location/Qualifiers
source 1..561
/organism="Atta cephalotes"
/mol_type="mRNA"
/db_xref="taxon:12957"
/chromosome="Unknown"
/sex="male"
gene 1..561
/gene="LOC105625738"
/note="Derived by automated computational analysis using
gene prediction method: Gnomon. Supporting evidence
includes similarity to: 2 Proteins"
/db_xref="GeneID:105625738"
CDS 1..561
/gene="LOC105625738"
/codon_start=1
/product="uncharacterized protein LOC105625738"
/protein_id="XP_012062449.1"
/db_xref="GeneID:105625738"
/translation="MKSAGWTSRQREPVKFFESWAMKEGEDKRKRERRKSVGDGGAES
ERRSRRWSVEDGCAPSRLRVTLWKGRLYPAYSLSGSEGEDNTSSLRSRAYPQNNPTNQ
SHHNHYNTSQHKQRAYQQQQQHPLYHMPGSGAGLSDTPTSGNASDETLTDSDLITVAR
DSALLVHNGEYDNNSCKYSYGKFVSL"
ORIGIN
1 atgaagtctg cagggtggac gtcgaggcag agggagccag taaaattctt cgagtcatgg
61 gcgatgaaag aaggagaaga caagagaaag agggaaagga ggaaaagcgt cggggatggt
121 ggtgcggaaa gtgaaagaag gagcagaaga tggagtgtcg aggacggttg tgcaccgtcg
181 cgactgaggg tgactctgtg gaagggacgg ctttatccgg cctacagtct aagtggcagc
241 gagggtgagg ataatacctc cagtttacgt agtcgagcct atccacaaaa taatccaacc
301 aaccaatccc atcataatca ttacaacacg agtcaacaca aacagcgtgc atatcaacag
361 caacaacaac atcctctata tcatatgccc ggcagtggtg ccggtctcag tgacacaccg
421 acttccggta acgcatctga cgaaactctc actgatagtg accttatcac tgttgctcgc
481 gattctgcgc tgctcgtcca taacggtgag tacgacaata attcttgtaa atattcatac
541 ggtaagtttg tatctctgtg a
//