Dbfetch

Dbfetch

LOCUS       XM_012206837             462 bp    mRNA    linear   INV 02-APR-2015
DEFINITION  PREDICTED: Atta cephalotes cyclic AMP-responsive element-binding
            protein 1-like (LOC105625513), partial mRNA.
ACCESSION   XM_012206837
VERSION     XM_012206837.1
DBLINK      BioProject: PRJNA279976
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Atta cephalotes
  ORGANISM  Atta cephalotes
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
            Aculeata; Formicoidea; Formicidae; Myrmicinae; Atta.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_012132261.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Atta cephalotes Annotation Release
                                           100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 1% of CDS bases
            ##RefSeq-Attributes-END##
            COMPLETENESS: incomplete on the 5' end.
FEATURES             Location/Qualifiers
     source          1..462
                     /organism="Atta cephalotes"
                     /mol_type="mRNA"
                     /db_xref="taxon:12957"
                     /chromosome="Unknown"
                     /sex="male"
     gene            <1..462
                     /gene="LOC105625513"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 19 Proteins"
                     /db_xref="GeneID:105625513"
     CDS             <1..462
                     /gene="LOC105625513"
                     /codon_start=1
                     /product="cyclic AMP-responsive element-binding protein
                     1-like"
                     /protein_id="XP_012062227.1"
                     /db_xref="GeneID:105625513"
                     /translation="FGVTDGRLPPLESSSECDSNVDSEVSSHSLHYQTVIPAGTIQIA
                     TQGEGVPGLHTLTMSNAATAGGAIVQYAQGQDTQFFVPAYTGHGVVVEDAARKRELRL
                     LKNREAARECRRKKKEYIKCLENRVAVLENRNQTLIDELKSLKELYQQKTD"
ORIGIN      
        1 ttcggtgtta cagacggtcg tttgcccccc ttagaatcat cctccgagtg tgattctaac
       61 gtggacagtg aagtgtcttc ccattcgctc cattatcaaa cagtaattcc tgccggtact
      121 atacaaattg cgacccaagg ggagggagtt ccggggcttc acacgttaac tatgagcaat
      181 gcggcgacag cgggtggagc tatagtgcag tatgcacagg gccaggacac tcaatttttt
      241 gtcccagctt atacaggtca cggagtagta gtggaggatg cggcacgaaa gagagagtta
      301 aggttgctta agaacagaga agcggcacgt gaatgtagaa gaaagaagaa agaatatata
      361 aagtgcttag aaaatcgtgt tgcggtgctg gagaatagaa atcagacact aatcgacgaa
      421 ctgaaatcgt taaaagaatt atatcagcag aaaaccgact ga
//