Dbfetch
LOCUS XM_012206827 701 bp mRNA linear INV 02-APR-2015
DEFINITION PREDICTED: Atta cephalotes rho GTPase-activating protein 8-like
(LOC105625503), partial mRNA.
ACCESSION XM_012206827
VERSION XM_012206827.1
DBLINK BioProject: PRJNA279976
KEYWORDS RefSeq; includes ab initio.
SOURCE Atta cephalotes
ORGANISM Atta cephalotes
Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
Aculeata; Formicoidea; Formicidae; Myrmicinae; Atta.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NW_012132126.1) annotated using gene prediction method: Gnomon.
Also see:
Documentation of NCBI's Annotation Process
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI
Annotation Status :: Full annotation
Annotation Version :: Atta cephalotes Annotation Release
100
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 6.2
Annotation Method :: Best-placed RefSeq; Gnomon
Features Annotated :: Gene; mRNA; CDS; ncRNA
##Genome-Annotation-Data-END##
##RefSeq-Attributes-START##
ab initio :: 1% of CDS bases
##RefSeq-Attributes-END##
COMPLETENESS: incomplete on the 3' end.
FEATURES Location/Qualifiers
source 1..701
/organism="Atta cephalotes"
/mol_type="mRNA"
/db_xref="taxon:12957"
/chromosome="Unknown"
/sex="male"
gene 1..>701
/gene="LOC105625503"
/note="Derived by automated computational analysis using
gene prediction method: Gnomon. Supporting evidence
includes similarity to: 5 Proteins"
/db_xref="GeneID:105625503"
CDS 1..>701
/gene="LOC105625503"
/codon_start=1
/product="rho GTPase-activating protein 8-like"
/protein_id="XP_012062217.1"
/db_xref="GeneID:105625503"
/translation="MEADYQPTLSPSRTLTGMGNDCEDPYPSLSDYHDYEPNLEFDDT
ELQTTSNNATRLLEGKLDLVSSSIGAGMDYMESPVSDGTIEENFEEALVDAPVIESAD
DLAALDGELADEEDYLDISRHGIVEVVGDDSAGRKIIVVSACKLPPIGKETFNHAKLL
RYLTHTLDMFVEQDYSLVYFHYGLTSKNKPPLSWLWQAYKAFDRKYKKNLKALYLVHP
TNFIRIVWQIFKPAI"
ORIGIN
1 atggaggcgg actaccagcc gacgctaagt ccgtcgcgga cgttgacagg aatgggcaac
61 gactgtgaag atccatatcc tagtctgtca gattatcacg attatgaacc aaatctggaa
121 tttgacgata cagaattgca aactacttca aataatgcaa caagacttct ggaaggaaaa
181 ttggatttgg tgagcagtag cataggtgct gggatggatt atatggaaag cccagtgagt
241 gatggcacaa ttgaggagaa ctttgaggaa gctttggtag atgctccagt tattgaatct
301 gcggacgatc tggctgcttt agatggagag ctcgccgatg aggaagatta tcttgacata
361 tccagacatg gtatcgtaga ggtagtcggc gacgatagtg ccggtcgtaa aataattgtt
421 gtgtcagctt gcaaattgcc ccctattgga aaagaaacct ttaatcatgc taaacttctc
481 aggtacctta ctcatacttt ggatatgttc gtggaacaag attatagtct cgtctacttt
541 cattatggcc ttacgtcgaa gaataagcca cccttatctt ggttgtggca agcgtataag
601 gcgtttgata gaaaatacaa gaagaatctc aaagctctgt atctagtaca tccgactaat
661 tttattagga ttgtatggca aatatttaaa ccagctatta g
//