Dbfetch

LOCUS       XM_012206827             701 bp    mRNA    linear   INV 02-APR-2015
DEFINITION  PREDICTED: Atta cephalotes rho GTPase-activating protein 8-like
            (LOC105625503), partial mRNA.
ACCESSION   XM_012206827
VERSION     XM_012206827.1
DBLINK      BioProject: PRJNA279976
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Atta cephalotes
  ORGANISM  Atta cephalotes
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
            Aculeata; Formicoidea; Formicidae; Myrmicinae; Atta.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_012132126.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Atta cephalotes Annotation Release
                                           100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 1% of CDS bases
            ##RefSeq-Attributes-END##
            COMPLETENESS: incomplete on the 3' end.
FEATURES             Location/Qualifiers
     source          1..701
                     /organism="Atta cephalotes"
                     /mol_type="mRNA"
                     /db_xref="taxon:12957"
                     /chromosome="Unknown"
                     /sex="male"
     gene            1..>701
                     /gene="LOC105625503"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 5 Proteins"
                     /db_xref="GeneID:105625503"
     CDS             1..>701
                     /gene="LOC105625503"
                     /codon_start=1
                     /product="rho GTPase-activating protein 8-like"
                     /protein_id="XP_012062217.1"
                     /db_xref="GeneID:105625503"
                     /translation="MEADYQPTLSPSRTLTGMGNDCEDPYPSLSDYHDYEPNLEFDDT
                     ELQTTSNNATRLLEGKLDLVSSSIGAGMDYMESPVSDGTIEENFEEALVDAPVIESAD
                     DLAALDGELADEEDYLDISRHGIVEVVGDDSAGRKIIVVSACKLPPIGKETFNHAKLL
                     RYLTHTLDMFVEQDYSLVYFHYGLTSKNKPPLSWLWQAYKAFDRKYKKNLKALYLVHP
                     TNFIRIVWQIFKPAI"
ORIGIN      
        1 atggaggcgg actaccagcc gacgctaagt ccgtcgcgga cgttgacagg aatgggcaac
       61 gactgtgaag atccatatcc tagtctgtca gattatcacg attatgaacc aaatctggaa
      121 tttgacgata cagaattgca aactacttca aataatgcaa caagacttct ggaaggaaaa
      181 ttggatttgg tgagcagtag cataggtgct gggatggatt atatggaaag cccagtgagt
      241 gatggcacaa ttgaggagaa ctttgaggaa gctttggtag atgctccagt tattgaatct
      301 gcggacgatc tggctgcttt agatggagag ctcgccgatg aggaagatta tcttgacata
      361 tccagacatg gtatcgtaga ggtagtcggc gacgatagtg ccggtcgtaa aataattgtt
      421 gtgtcagctt gcaaattgcc ccctattgga aaagaaacct ttaatcatgc taaacttctc
      481 aggtacctta ctcatacttt ggatatgttc gtggaacaag attatagtct cgtctacttt
      541 cattatggcc ttacgtcgaa gaataagcca cccttatctt ggttgtggca agcgtataag
      601 gcgtttgata gaaaatacaa gaagaatctc aaagctctgt atctagtaca tccgactaat
      661 tttattagga ttgtatggca aatatttaaa ccagctatta g
//