Dbfetch

LOCUS       XM_012206528             469 bp    mRNA    linear   INV 02-APR-2015
DEFINITION  PREDICTED: Atta cephalotes thioredoxin-related transmembrane
            protein 1-like (LOC105625188), partial mRNA.
ACCESSION   XM_012206528
VERSION     XM_012206528.1
DBLINK      BioProject: PRJNA279976
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Atta cephalotes
  ORGANISM  Atta cephalotes
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
            Aculeata; Formicoidea; Formicidae; Myrmicinae; Atta.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_012130304.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Atta cephalotes Annotation Release
                                           100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 1% of CDS bases
            ##RefSeq-Attributes-END##
            COMPLETENESS: incomplete on the 3' end.
FEATURES             Location/Qualifiers
     source          1..469
                     /organism="Atta cephalotes"
                     /mol_type="mRNA"
                     /db_xref="taxon:12957"
                     /chromosome="Unknown"
                     /sex="male"
     gene            1..>469
                     /gene="LOC105625188"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 long SRA read, 1 Protein"
                     /db_xref="GeneID:105625188"
     CDS             150..>469
                     /gene="LOC105625188"
                     /codon_start=1
                     /product="thioredoxin-related transmembrane protein
                     1-like"
                     /protein_id="XP_012061918.1"
                     /db_xref="GeneID:105625188"
                     /translation="MGPVFYVIYVALLSTYARASIDTNTRRTKGSLVEQLNEDNWNLM
                     LTGEWMIEFYAPWCPACKALEPVWEDLASSKKDLNINVGKIDVTDSPGLSGRFLVTAL
                     PTIY"
ORIGIN      
        1 gctcagtcag cgccgtcaac gtcagcggtg atcagcggtt ggcgtcgtgt acgatagtga
       61 tagtgtggtc aagtgtggtt gagttgagtg tgatacggtg ccggtgacgg gtgagtgttg
      121 gttaaagtcg acggtgagac gtcgccagaa tgggtcccgt attttatgtc atctacgtcg
      181 cattattatc cacgtacgcg agagcgagca tagacacgaa tacgcggcgg acgaagggca
      241 gcctggtgga acaactgaac gaggataact ggaatcttat gcttactgga gagtggatga
      301 ttgagtttta tgcaccatgg tgtccagctt gtaaagcact tgaaccagtc tgggaggatc
      361 ttgcatcatc caaaaaggat ttaaatatca atgttggaaa gatagacgtg acagattctc
      421 caggtcttag tggcagattt ttggttacag ctttgcctac catatatca
//