Dbfetch
LOCUS XM_012206528 469 bp mRNA linear INV 02-APR-2015
DEFINITION PREDICTED: Atta cephalotes thioredoxin-related transmembrane
protein 1-like (LOC105625188), partial mRNA.
ACCESSION XM_012206528
VERSION XM_012206528.1
DBLINK BioProject: PRJNA279976
KEYWORDS RefSeq; includes ab initio.
SOURCE Atta cephalotes
ORGANISM Atta cephalotes
Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
Aculeata; Formicoidea; Formicidae; Myrmicinae; Atta.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NW_012130304.1) annotated using gene prediction method: Gnomon.
Also see:
Documentation of NCBI's Annotation Process
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI
Annotation Status :: Full annotation
Annotation Version :: Atta cephalotes Annotation Release
100
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 6.2
Annotation Method :: Best-placed RefSeq; Gnomon
Features Annotated :: Gene; mRNA; CDS; ncRNA
##Genome-Annotation-Data-END##
##RefSeq-Attributes-START##
ab initio :: 1% of CDS bases
##RefSeq-Attributes-END##
COMPLETENESS: incomplete on the 3' end.
FEATURES Location/Qualifiers
source 1..469
/organism="Atta cephalotes"
/mol_type="mRNA"
/db_xref="taxon:12957"
/chromosome="Unknown"
/sex="male"
gene 1..>469
/gene="LOC105625188"
/note="Derived by automated computational analysis using
gene prediction method: Gnomon. Supporting evidence
includes similarity to: 1 long SRA read, 1 Protein"
/db_xref="GeneID:105625188"
CDS 150..>469
/gene="LOC105625188"
/codon_start=1
/product="thioredoxin-related transmembrane protein
1-like"
/protein_id="XP_012061918.1"
/db_xref="GeneID:105625188"
/translation="MGPVFYVIYVALLSTYARASIDTNTRRTKGSLVEQLNEDNWNLM
LTGEWMIEFYAPWCPACKALEPVWEDLASSKKDLNINVGKIDVTDSPGLSGRFLVTAL
PTIY"
ORIGIN
1 gctcagtcag cgccgtcaac gtcagcggtg atcagcggtt ggcgtcgtgt acgatagtga
61 tagtgtggtc aagtgtggtt gagttgagtg tgatacggtg ccggtgacgg gtgagtgttg
121 gttaaagtcg acggtgagac gtcgccagaa tgggtcccgt attttatgtc atctacgtcg
181 cattattatc cacgtacgcg agagcgagca tagacacgaa tacgcggcgg acgaagggca
241 gcctggtgga acaactgaac gaggataact ggaatcttat gcttactgga gagtggatga
301 ttgagtttta tgcaccatgg tgtccagctt gtaaagcact tgaaccagtc tgggaggatc
361 ttgcatcatc caaaaaggat ttaaatatca atgttggaaa gatagacgtg acagattctc
421 caggtcttag tggcagattt ttggttacag ctttgcctac catatatca
//