Dbfetch

LOCUS       XM_012201195             315 bp    mRNA    linear   INV 02-APR-2015
DEFINITION  PREDICTED: Atta cephalotes uncharacterized LOC105619676
            (LOC105619676), mRNA.
ACCESSION   XM_012201195
VERSION     XM_012201195.1
DBLINK      BioProject: PRJNA279976
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Atta cephalotes
  ORGANISM  Atta cephalotes
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
            Aculeata; Formicoidea; Formicidae; Myrmicinae; Atta.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_012130086.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Atta cephalotes Annotation Release
                                           100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 5% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..315
                     /organism="Atta cephalotes"
                     /mol_type="mRNA"
                     /db_xref="taxon:12957"
                     /chromosome="Unknown"
                     /sex="male"
     gene            1..315
                     /gene="LOC105619676"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins"
                     /db_xref="GeneID:105619676"
     CDS             1..315
                     /gene="LOC105619676"
                     /codon_start=1
                     /product="uncharacterized protein LOC105619676"
                     /protein_id="XP_012056585.1"
                     /db_xref="GeneID:105619676"
                     /translation="MLFYLILIAASPFVITAFPQNLDNIPVETAQEPVAFKSNGKQET
                     TVLSTNADCVIPEDRNTDCMKNCPMNRNDCNPVCGTDGVSYINKSELQCMRHCGKSEC
                     AS"
ORIGIN      
        1 atgttgtttt atttaatatt gattgctgca tcgccgtttg tcattaccgc gtttccacaa
       61 aatttggata acatacctgt ggagacggct caagagccag tggctttcaa atccaatgga
      121 aagcaagaaa caactgtatt atccacaaac gctgattgtg ttatacctga agatagaaat
      181 accgattgca tgaaaaactg tcctatgaat agaaacgact gcaatcctgt ttgtggaacg
      241 gatggtgtat catacattaa taaaagtgaa ctacaatgca tgagacattg tggaaaaagt
      301 gagtgtgctt cataa
//