Dbfetch
LOCUS XM_012201195 315 bp mRNA linear INV 02-APR-2015
DEFINITION PREDICTED: Atta cephalotes uncharacterized LOC105619676
(LOC105619676), mRNA.
ACCESSION XM_012201195
VERSION XM_012201195.1
DBLINK BioProject: PRJNA279976
KEYWORDS RefSeq; includes ab initio.
SOURCE Atta cephalotes
ORGANISM Atta cephalotes
Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
Aculeata; Formicoidea; Formicidae; Myrmicinae; Atta.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NW_012130086.1) annotated using gene prediction method: Gnomon.
Also see:
Documentation of NCBI's Annotation Process
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI
Annotation Status :: Full annotation
Annotation Version :: Atta cephalotes Annotation Release
100
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 6.2
Annotation Method :: Best-placed RefSeq; Gnomon
Features Annotated :: Gene; mRNA; CDS; ncRNA
##Genome-Annotation-Data-END##
##RefSeq-Attributes-START##
ab initio :: 5% of CDS bases
##RefSeq-Attributes-END##
FEATURES Location/Qualifiers
source 1..315
/organism="Atta cephalotes"
/mol_type="mRNA"
/db_xref="taxon:12957"
/chromosome="Unknown"
/sex="male"
gene 1..315
/gene="LOC105619676"
/note="Derived by automated computational analysis using
gene prediction method: Gnomon. Supporting evidence
includes similarity to: 2 Proteins"
/db_xref="GeneID:105619676"
CDS 1..315
/gene="LOC105619676"
/codon_start=1
/product="uncharacterized protein LOC105619676"
/protein_id="XP_012056585.1"
/db_xref="GeneID:105619676"
/translation="MLFYLILIAASPFVITAFPQNLDNIPVETAQEPVAFKSNGKQET
TVLSTNADCVIPEDRNTDCMKNCPMNRNDCNPVCGTDGVSYINKSELQCMRHCGKSEC
AS"
ORIGIN
1 atgttgtttt atttaatatt gattgctgca tcgccgtttg tcattaccgc gtttccacaa
61 aatttggata acatacctgt ggagacggct caagagccag tggctttcaa atccaatgga
121 aagcaagaaa caactgtatt atccacaaac gctgattgtg ttatacctga agatagaaat
181 accgattgca tgaaaaactg tcctatgaat agaaacgact gcaatcctgt ttgtggaacg
241 gatggtgtat catacattaa taaaagtgaa ctacaatgca tgagacattg tggaaaaagt
301 gagtgtgctt cataa
//