Dbfetch

Dbfetch

LOCUS       XM_012200633             813 bp    mRNA    linear   INV 02-APR-2015
DEFINITION  PREDICTED: Atta cephalotes uncharacterized LOC105619101
            (LOC105619101), mRNA.
ACCESSION   XM_012200633
VERSION     XM_012200633.1
DBLINK      BioProject: PRJNA279976
KEYWORDS    RefSeq.
SOURCE      Atta cephalotes
  ORGANISM  Atta cephalotes
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
            Aculeata; Formicoidea; Formicidae; Myrmicinae; Atta.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_012130083.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Atta cephalotes Annotation Release
                                           100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..813
                     /organism="Atta cephalotes"
                     /mol_type="mRNA"
                     /db_xref="taxon:12957"
                     /chromosome="Unknown"
                     /sex="male"
     gene            1..813
                     /gene="LOC105619101"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 long SRA read, 18 Proteins"
                     /db_xref="GeneID:105619101"
     CDS             1..813
                     /gene="LOC105619101"
                     /codon_start=1
                     /product="uncharacterized protein LOC105619101"
                     /protein_id="XP_012056023.1"
                     /db_xref="GeneID:105619101"
                     /translation="MRTYFVIAAILIAGTNGQESFKCPDDFGFYPHHISCDKYWKCDN
                     SVAELKTCGNGLAFDASDNKFLTENCDYLHNVDCGERTQLEPPIGTPHCARLYGIFPD
                     EKKCDVFWNCWNGEASRYQCSPGLAYDREARVCMWADQVPECRNEEVAGGFTCPAAGE
                     VSGASGSFSRHAHPEDCRKYYICLEGIAREYGCPIGTVFKIGDADGSGACEDPEDVPG
                     CEDYYGDLDLKSIRKSELLAGIQSEPRKPNQAVLKPRPTTVGGPTRPSPIQE"
ORIGIN      
        1 atgaggacgt acttcgtgat agccgccata ctgatcgccg gaacgaacgg tcaggagtct
       61 ttcaaatgtc cggatgactt cgggttctat cctcatcaca tatcgtgcga caagtattgg
      121 aaatgcgaca acagcgtggc ggaactgaag acgtgtggca acggtctggc atttgacgcc
      181 agcgataaca agttcctcac cgagaactgc gattatctgc acaatgtaga ctgcggcgag
      241 cgcacgcagc tcgaaccgcc tattggcacg ccacattgcg ctcgcctcta cggcatcttc
      301 cctgatgaga agaagtgtga tgtcttctgg aactgttgga atggcgaggc ctcccgttat
      361 cagtgcagtc ctggactggc ctatgaccgt gaagccaggg tgtgcatgtg ggccgatcag
      421 gtgcccgaat gcagaaacga agaggtcgcc ggaggtttca cgtgtccggc tgcgggagaa
      481 gtgagcggtg catccggcag cttcagcaga cacgcccatc cggaggattg cagaaagtac
      541 tacatatgcc ttgagggcat cgccagggaa tacggttgcc cgattggcac agttttcaag
      601 atcggcgatg ccgatggcag cggcgcttgc gaggatcccg aagatgttcc cggatgtgag
      661 gattactacg gtgacctgga tctgaagagc atccggaaga gcgagctgct tgctggtatc
      721 cagagtgagc ccagaaagcc gaaccaggcg gtcctcaaac ctaggcccac aacagtagga
      781 gggcccacga ggccctcacc catccaggaa taa
//

Unexpected Error when closing connection to refseq from NCBI E-utilities. Non-zero exit status returned (255). STDERR: "http status: 429 Too Many Requests   at /nfs/public/rw/es/projects/jdbfetch/util/ncbi_refseq_fetch.pl line 124."