Dbfetch

Dbfetch

LOCUS       XM_012199437             618 bp    mRNA    linear   INV 02-APR-2015
DEFINITION  PREDICTED: Atta cephalotes uncharacterized LOC105617897
            (LOC105617897), mRNA.
ACCESSION   XM_012199437
VERSION     XM_012199437.1
DBLINK      BioProject: PRJNA279976
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Atta cephalotes
  ORGANISM  Atta cephalotes
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
            Aculeata; Formicoidea; Formicidae; Myrmicinae; Atta.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_012130078.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Atta cephalotes Annotation Release
                                           100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 32% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..618
                     /organism="Atta cephalotes"
                     /mol_type="mRNA"
                     /db_xref="taxon:12957"
                     /chromosome="Unknown"
                     /sex="male"
     gene            1..618
                     /gene="LOC105617897"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein"
                     /db_xref="GeneID:105617897"
     CDS             1..618
                     /gene="LOC105617897"
                     /codon_start=1
                     /product="uncharacterized protein LOC105617897"
                     /protein_id="XP_012054827.1"
                     /db_xref="GeneID:105617897"
                     /translation="MRAPWLVLILIVILDPLLLLWEAVCHRNDTNLSAASQRSGETLS
                     RRRRELTFPKGSAFVMTLVLLKAIQLNEPKNWNLDLEFDTTWPIPSQEDLKKVTSIKR
                     PSKLKRRHRRELYANLELALDSRNLPGRLCILRTICEAETILSPPGFSIIEDAIRIIL
                     RNFEDADNYDCYDVAYRMKSDCEVVYPCPFSLLKLLLYNLYTGET"
ORIGIN      
        1 atgagagccc cgtggctcgt cctgattctc attgtgatcc tggacccgtt gttgctcctg
       61 tgggaggcgg tatgtcaccg taatgacacc aacttaagtg ccgctagcca aaggtcagga
      121 gagactctgt ccaggcggag acgggagctc acttttccaa agggaagcgc tttcgtgatg
      181 actcttgttt tgctaaaggc tattcaactt aatgagccta aaaactggaa tttagaccta
      241 gaattcgata caacatggcc tatacctagc caagaagatt taaagaaggt tacttctatc
      301 aaaagaccgt ctaaactaaa acgacgacat aggcgcgaac tttatgctaa tttggaatta
      361 gcattggaca gtcgaaactt accaggacga ttatgtattc tgcgcacaat ttgcgaagcg
      421 gaaacaatac taagtccccc aggattttca attatcgaag atgctatacg aattatttta
      481 agaaatttcg aagatgctga taattacgat tgctacgatg ttgcatatcg aatgaaaagt
      541 gactgtgagg ttgtttatcc ttgtccattt tcactcttga aattattgtt atataattta
      601 tatacagggg aaacgtga
//