Dbfetch

LOCUS       XM_002113059             546 bp    mRNA    linear   INV 12-AUG-2008
DEFINITION  Trichoplax adhaerens hypothetical protein, mRNA.
ACCESSION   XM_002113059
VERSION     XM_002113059.1
KEYWORDS    RefSeq.
SOURCE      Trichoplax adhaerens
  ORGANISM  Trichoplax adhaerens
            Eukaryota; Metazoa; Placozoa; Trichoplax.
REFERENCE   1  (bases 1 to 546)
  AUTHORS   Srivastava,M., Begovic,E., Chapman,J., Putnam,N.H., Hellsten,U.,
            Kawashima,T., Kuo,A., Mitros,T., Salamov,A., Carpenter,M.L.,
            Signorovitch,A.Y., Moreno,M.A., Kamm,K., Grimwood,J., Schmutz,J.,
            Shapiro,H., Grigoriev,I.V., Buss,L.W., Schierwater,B.,
            Dellaporta,S.L. and Rokhsar,D.S.
  CONSRTM   US DOE Joint Genome Institute (JGI-PGF)
  TITLE     The Trichoplax genome and the nature of placozoans
  JOURNAL   Nature 454 (7207), 955-960 (2008)
   PUBMED   18719581
REFERENCE   2  (bases 1 to 546)
  AUTHORS   Kuo,A., Lucas,S., Glavina del Rio,T., Dahlin,E., Tice,H.,
            Pitluck,S., Zhou,K., Srivastava,M., Begovic,E., Chapman,J.,
            Putnam,N.H., Hellsten,U., Kawashima,T., Mitros,T., Salamov,A.,
            Carpenter,M.L., Signorovitch,A.Y., Moreno,M.A., Kamm,K.,
            Grimwood,J., Schmutz,J., Shapiro,H., Grigoriev,I.V., Buss,L.W.,
            Schierwater,B., Dellaporta,S.L. and Rokhsar,D.S.
  CONSRTM   US DOE Joint Genome Institute (JGI-PGF)
  TITLE     Direct Submission
  JOURNAL   Submitted (12-JUN-2008) US DOE Joint Genome Institute, 2800
            Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_002060947).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..546
                     /organism="Trichoplax adhaerens"
                     /mol_type="mRNA"
                     /strain="Grell-BS-1999"
                     /db_xref="taxon:10228"
     gene            <1..>546
                     /locus_tag="TRIADDRAFT_56913"
                     /db_xref="GeneID:6753873"
     CDS             1..546
                     /locus_tag="TRIADDRAFT_56913"
                     /note="similar to unnamed protein product"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002113095.1"
                     /db_xref="InterPro:IPR001092"
                     /db_xref="GeneID:6753873"
                     /translation="MADQFDTNLDFDIIDMELNQANAATITHVIENSFVDLDSIYFIS
                     PTTTFNSDQGDLTERAIRISSTRQPPSSIFSNRPAKKSATTPTMARRRKRKPPTGEQR
                     EAANNRERRRMNVMNSAFDTLRQHLPTFSYETKLSKIDTLKLSIYYINFMCKLLQDTA
                     NLDGHEQIDANNLANLQSYLS"
ORIGIN      
        1 atggcggatc aatttgatac taacttagat ttcgatataa tcgatatgga attaaatcaa
       61 gcaaatgctg caactataac acacgtgatt gagaatagtt ttgttgatct agatagcatt
      121 tacttcattt ctcctaccac aactttcaat tccgatcaag gcgacttaac cgaacgtgca
      181 ataaggatat cctccacacg acaacctcct tcctcaatct ttagcaatag acctgccaag
      241 aaatcggcca caacgccaac tatggcgagg agacgaaaac gtaagcctcc aaccggtgaa
      301 caacgtgaag cagctaataa tcgcgaaagg agacgtatga atgttatgaa tagtgctttc
      361 gatactttac gccaacactt accaactttc tcttacgaga ctaaactatc taaaatcgat
      421 accttaaaat tatctatcta ttatattaat tttatgtgta agctgttgca agatacagct
      481 aaccttgatg gccatgagca aattgatgct aataatttag cgaatttaca gagctatcta
      541 tcatga
//