Dbfetch

LOCUS       XM_002111232             168 bp    mRNA    linear   INV 12-AUG-2008
DEFINITION  Trichoplax adhaerens hypothetical protein, mRNA.
ACCESSION   XM_002111232
VERSION     XM_002111232.1
KEYWORDS    RefSeq.
SOURCE      Trichoplax adhaerens
  ORGANISM  Trichoplax adhaerens
            Eukaryota; Metazoa; Placozoa; Trichoplax.
REFERENCE   1  (bases 1 to 168)
  AUTHORS   Srivastava,M., Begovic,E., Chapman,J., Putnam,N.H., Hellsten,U.,
            Kawashima,T., Kuo,A., Mitros,T., Salamov,A., Carpenter,M.L.,
            Signorovitch,A.Y., Moreno,M.A., Kamm,K., Grimwood,J., Schmutz,J.,
            Shapiro,H., Grigoriev,I.V., Buss,L.W., Schierwater,B.,
            Dellaporta,S.L. and Rokhsar,D.S.
  CONSRTM   US DOE Joint Genome Institute (JGI-PGF)
  TITLE     The Trichoplax genome and the nature of placozoans
  JOURNAL   Nature 454 (7207), 955-960 (2008)
   PUBMED   18719581
REFERENCE   2  (bases 1 to 168)
  AUTHORS   Kuo,A., Lucas,S., Glavina del Rio,T., Dahlin,E., Tice,H.,
            Pitluck,S., Zhou,K., Srivastava,M., Begovic,E., Chapman,J.,
            Putnam,N.H., Hellsten,U., Kawashima,T., Mitros,T., Salamov,A.,
            Carpenter,M.L., Signorovitch,A.Y., Moreno,M.A., Kamm,K.,
            Grimwood,J., Schmutz,J., Shapiro,H., Grigoriev,I.V., Buss,L.W.,
            Schierwater,B., Dellaporta,S.L. and Rokhsar,D.S.
  CONSRTM   US DOE Joint Genome Institute (JGI-PGF)
  TITLE     Direct Submission
  JOURNAL   Submitted (12-JUN-2008) US DOE Joint Genome Institute, 2800
            Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_002060945).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..168
                     /organism="Trichoplax adhaerens"
                     /mol_type="mRNA"
                     /strain="Grell-BS-1999"
                     /db_xref="taxon:10228"
     gene            <1..>168
                     /locus_tag="TRIADDRAFT_9370"
                     /db_xref="GeneID:6751927"
     CDS             <1..>168
                     /locus_tag="TRIADDRAFT_9370"
                     /note="similar to bHLH transcription factor p48"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002111268.1"
                     /db_xref="InterPro:IPR001092"
                     /db_xref="GeneID:6751927"
                     /translation="QRLAANLRERKRMQSINHAFEDLRHLVPKLPYEKRLSKVNTLRL
                     AISYIGFMSELL"
ORIGIN      
        1 caacgcttag ccgctaatct acgcgaacga aaacgtatgc aaagtattaa tcatgcattc
       61 gaagatttac gccacttggt gcctaagtta ccatatgaaa aacgattatc caaagtcaat
      121 actttgagat tggcgatatc ttacattggt ttcatgtcgg aattgttg
//