Dbfetch
LOCUS XM_002103486 1035 bp mRNA linear INV 03-NOV-2021
DEFINITION PREDICTED: Drosophila simulans protein BCCIP homolog (LOC6728173),
mRNA.
ACCESSION XM_002103486
VERSION XM_002103486.4
DBLINK BioProject: PRJNA695671
KEYWORDS RefSeq.
SOURCE Drosophila simulans
ORGANISM Drosophila simulans
Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NC_052523.2) annotated using gene prediction method: Gnomon,
supported by EST evidence.
Also see:
Documentation of NCBI's Annotation Process
On Nov 3, 2021 this sequence version replaced XM_002103486.3.
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI
Annotation Status :: Full annotation
Annotation Name :: Drosophila simulans Annotation
Release 103
Annotation Version :: 103
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 9.0
Annotation Method :: Best-placed RefSeq; Gnomon
Features Annotated :: Gene; mRNA; CDS; ncRNA
##Genome-Annotation-Data-END##
FEATURES Location/Qualifiers
source 1..1035
/organism="Drosophila simulans"
/mol_type="mRNA"
/strain="w501"
/db_xref="taxon:7240"
/chromosome="3R"
/sex="female"
/tissue_type="whole body"
/dev_stage="adult"
/collection_date="2016-12"
/collected_by="Erika Gajda"
gene 1..1035
/gene="LOC6728173"
/note="Derived by automated computational analysis using
gene prediction method: Gnomon. Supporting evidence
includes similarity to: 2 ESTs, 3 Proteins, and 100%
coverage of the annotated genomic feature by RNAseq
alignments, including 103 samples with support for all
annotated introns"
/db_xref="GeneID:6728173"
CDS 124..1017
/gene="LOC6728173"
/codon_start=1
/product="protein BCCIP homolog"
/protein_id="XP_002103522.1"
/db_xref="GeneID:6728173"
/translation="MSASKQKKLNKMEVESNEDDSSSSEDDDDDEPHPDAYKGNEEVQ
IEFEGRAPVDPDAQGISQLLQRLFLRAHINLNQMADLIIAQNFIGSVICQCDDEGTES
ETEDDNMVEDGTIFGITSVLNLTAKKDQPSIAQLRTYILDRAKTHASQEVQQQLKEIL
DSEQRHVGFLINERFINIPAQISVPLLQSLQQEIEAAKAKKMKFDFGTLLLLVKFYRK
ESKKGKPGEDIYTNAEDELLSDRAKFSFEYSMASEADSGMAGDWLEGDAVMTPYRKLL
VLEAKKLPQLIDDIQRFINGE"
polyA_site 1035
/gene="LOC6728173"
/experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN
1 gagcacttaa cagcacgctg cgtaatagtt ggcaacgcaa tacaacacgt gcggacgata
61 aacagctggc tttgtaaatt gtggaagcga aacaaagcca aattcgttaa ctaaatctta
121 acaatgtctg ctagtaagca aaagaaactg aataaaatgg aggtggagtc caacgaggac
181 gactccagtt ccagcgagga tgatgacgac gacgaaccgc atccagatgc ctataaagga
241 aacgaggagg tgcaaatcga atttgaggga cgagctccgg tagatcccga tgcacaggga
301 atctctcaac tgctgcagcg actattcctt cgtgcccaca tcaacttaaa ccaaatggcg
361 gatctgatca tagcccaaaa tttcataggg agtgtgatct gccagtgcga cgatgagggt
421 acagagagcg aaacggagga cgacaacatg gtcgaggatg gcactatatt tggaatcacc
481 tctgtgctga acctgaccgc caaaaaggat cagcccagca tcgcccagtt aaggacctac
541 atactggatc gcgccaagac gcacgcttct caggaggttc agcagcagct gaaggagatt
601 ctagacagcg agcagcgcca tgtgggattc ttgatcaacg agcgctttat caacatccca
661 gcccagatct ccgtgccact gctgcagagt ctgcagcaag aaatcgaagc cgccaaggcc
721 aagaaaatga agttcgactt tggcactctg ctgctgctgg ttaagttcta caggaaagag
781 tcgaagaagg ggaaaccagg cgaggacatc tacaccaacg ctgaggatga gttgctttcg
841 gatcgggcta agttctcctt cgagtattcc atggcctctg aggccgattc gggcatggct
901 ggcgattggc tggaaggcga tgccgtgatg acaccctaca ggaaactcct ggtcctggag
961 gccaagaaac ttccgcagct tattgacgat atacaacgct ttattaatgg cgaataaata
1021 tttttgaatt taaaa
//