Dbfetch

LOCUS       XM_002103486            1035 bp    mRNA    linear   INV 03-NOV-2021
DEFINITION  PREDICTED: Drosophila simulans protein BCCIP homolog (LOC6728173),
            mRNA.
ACCESSION   XM_002103486
VERSION     XM_002103486.4
DBLINK      BioProject: PRJNA695671
KEYWORDS    RefSeq.
SOURCE      Drosophila simulans
  ORGANISM  Drosophila simulans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_052523.2) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Nov 3, 2021 this sequence version replaced XM_002103486.3.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila simulans Annotation
                                           Release 103
            Annotation Version          :: 103
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1035
                     /organism="Drosophila simulans"
                     /mol_type="mRNA"
                     /strain="w501"
                     /db_xref="taxon:7240"
                     /chromosome="3R"
                     /sex="female"
                     /tissue_type="whole body"
                     /dev_stage="adult"
                     /collection_date="2016-12"
                     /collected_by="Erika Gajda"
     gene            1..1035
                     /gene="LOC6728173"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 ESTs, 3 Proteins, and 100%
                     coverage of the annotated genomic feature by RNAseq
                     alignments, including 103 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:6728173"
     CDS             124..1017
                     /gene="LOC6728173"
                     /codon_start=1
                     /product="protein BCCIP homolog"
                     /protein_id="XP_002103522.1"
                     /db_xref="GeneID:6728173"
                     /translation="MSASKQKKLNKMEVESNEDDSSSSEDDDDDEPHPDAYKGNEEVQ
                     IEFEGRAPVDPDAQGISQLLQRLFLRAHINLNQMADLIIAQNFIGSVICQCDDEGTES
                     ETEDDNMVEDGTIFGITSVLNLTAKKDQPSIAQLRTYILDRAKTHASQEVQQQLKEIL
                     DSEQRHVGFLINERFINIPAQISVPLLQSLQQEIEAAKAKKMKFDFGTLLLLVKFYRK
                     ESKKGKPGEDIYTNAEDELLSDRAKFSFEYSMASEADSGMAGDWLEGDAVMTPYRKLL
                     VLEAKKLPQLIDDIQRFINGE"
     polyA_site      1035
                     /gene="LOC6728173"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gagcacttaa cagcacgctg cgtaatagtt ggcaacgcaa tacaacacgt gcggacgata
       61 aacagctggc tttgtaaatt gtggaagcga aacaaagcca aattcgttaa ctaaatctta
      121 acaatgtctg ctagtaagca aaagaaactg aataaaatgg aggtggagtc caacgaggac
      181 gactccagtt ccagcgagga tgatgacgac gacgaaccgc atccagatgc ctataaagga
      241 aacgaggagg tgcaaatcga atttgaggga cgagctccgg tagatcccga tgcacaggga
      301 atctctcaac tgctgcagcg actattcctt cgtgcccaca tcaacttaaa ccaaatggcg
      361 gatctgatca tagcccaaaa tttcataggg agtgtgatct gccagtgcga cgatgagggt
      421 acagagagcg aaacggagga cgacaacatg gtcgaggatg gcactatatt tggaatcacc
      481 tctgtgctga acctgaccgc caaaaaggat cagcccagca tcgcccagtt aaggacctac
      541 atactggatc gcgccaagac gcacgcttct caggaggttc agcagcagct gaaggagatt
      601 ctagacagcg agcagcgcca tgtgggattc ttgatcaacg agcgctttat caacatccca
      661 gcccagatct ccgtgccact gctgcagagt ctgcagcaag aaatcgaagc cgccaaggcc
      721 aagaaaatga agttcgactt tggcactctg ctgctgctgg ttaagttcta caggaaagag
      781 tcgaagaagg ggaaaccagg cgaggacatc tacaccaacg ctgaggatga gttgctttcg
      841 gatcgggcta agttctcctt cgagtattcc atggcctctg aggccgattc gggcatggct
      901 ggcgattggc tggaaggcga tgccgtgatg acaccctaca ggaaactcct ggtcctggag
      961 gccaagaaac ttccgcagct tattgacgat atacaacgct ttattaatgg cgaataaata
     1021 tttttgaatt taaaa
//