Dbfetch

Dbfetch

LOCUS       XM_002103182             693 bp    mRNA    linear   INV 03-NOV-2021
DEFINITION  PREDICTED: Drosophila simulans histone deacetylase complex subunit
            SAP18 (LOC6727863), mRNA.
ACCESSION   XM_002103182
VERSION     XM_002103182.4
DBLINK      BioProject: PRJNA695671
KEYWORDS    RefSeq.
SOURCE      Drosophila simulans
  ORGANISM  Drosophila simulans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_052523.2) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Nov 3, 2021 this sequence version replaced XM_002103182.3.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila simulans Annotation
                                           Release 103
            Annotation Version          :: 103
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..693
                     /organism="Drosophila simulans"
                     /mol_type="mRNA"
                     /strain="w501"
                     /db_xref="taxon:7240"
                     /chromosome="3R"
                     /sex="female"
                     /tissue_type="whole body"
                     /dev_stage="adult"
                     /collection_date="2016-12"
                     /collected_by="Erika Gajda"
     gene            1..693
                     /gene="LOC6727863"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 7 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 116 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:6727863"
     CDS             141..593
                     /gene="LOC6727863"
                     /codon_start=1
                     /product="histone deacetylase complex subunit SAP18"
                     /protein_id="XP_002103218.1"
                     /db_xref="GeneID:6727863"
                     /translation="MANVESMIVEEKTQVKQIDREKTCPLLLRVFCSTGRHHSVSEYM
                     FGNVPTNELQIYTWQDATLHELTSLVRDVNPDTRKKGTYFDFAVVYPNFRSNHFQMRE
                     IGVTCTGQKGIDDNKTLAQAKFSIGDFLDISITPPNRLPPTARRQRPY"
     polyA_site      693
                     /gene="LOC6727863"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cgccgatgtg cgataggttt gctgcattcg attatatact tatcgaaaag agcaaagaga
       61 agccgaatat tcggcaataa aagtgaattt tgtattaaaa ttaaggaaat taataacgat
      121 acatcgcaga acagggagac atggccaacg tggagtctat gattgtggag gaaaagacgc
      181 aggtcaagca gattgaccgc gagaagacct gtccgctgct gctccgcgtc ttctgctcta
      241 cgggacgaca ccactccgtg tcggagtata tgttcggcaa cgtgcccacc aacgagcttc
      301 agatttacac ctggcaagac gccaccctcc acgaactgac ctccctggtg cgcgacgtca
      361 atccggatac ccggaagaag ggcacctact ttgactttgc cgtcgtgtac cccaacttcc
      421 ggagcaatca cttccagatg cgcgaaatcg gagtgacctg cacgggtcaa aaaggaatcg
      481 atgataataa gacacttgca caggccaaat tcagcattgg agactttctg gacatctcga
      541 ttactccgcc caaccgactg ccgcccactg ccaggcgcca gcgtccctac tgattctgca
      601 ctttcatcta ttctaatcat tttaatcttt cacttgacac tcaatggagt atggacataa
      661 ttataagtgg aatacaagta agacgaacta cga
//