Dbfetch
LOCUS XM_002084132 591 bp mRNA linear INV 03-NOV-2021
DEFINITION PREDICTED: Drosophila simulans chorion protein S15 (LOC6737330),
mRNA.
ACCESSION XM_002084132
VERSION XM_002084132.4
DBLINK BioProject: PRJNA695671
KEYWORDS RefSeq.
SOURCE Drosophila simulans
ORGANISM Drosophila simulans
Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NC_052522.2) annotated using gene prediction method: Gnomon,
supported by EST evidence.
Also see:
Documentation of NCBI's Annotation Process
On Nov 3, 2021 this sequence version replaced XM_002084132.3.
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI
Annotation Status :: Full annotation
Annotation Name :: Drosophila simulans Annotation
Release 103
Annotation Version :: 103
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 9.0
Annotation Method :: Best-placed RefSeq; Gnomon
Features Annotated :: Gene; mRNA; CDS; ncRNA
##Genome-Annotation-Data-END##
FEATURES Location/Qualifiers
source 1..591
/organism="Drosophila simulans"
/mol_type="mRNA"
/strain="w501"
/db_xref="taxon:7240"
/chromosome="3L"
/sex="female"
/tissue_type="whole body"
/dev_stage="adult"
/collection_date="2016-12"
/collected_by="Erika Gajda"
gene 1..591
/gene="LOC6737330"
/note="Derived by automated computational analysis using
gene prediction method: Gnomon. Supporting evidence
includes similarity to: 107 ESTs, 3 Proteins, and 100%
coverage of the annotated genomic feature by RNAseq
alignments, including 39 samples with support for all
annotated introns"
/db_xref="GeneID:6737330"
CDS 115..462
/gene="LOC6737330"
/codon_start=1
/product="chorion protein S15"
/protein_id="XP_002084168.1"
/db_xref="GeneID:6737330"
/translation="MKYLIACVTLALFAYINASPAYGNRGGYGGVYGGGYGGVQRVVY
EEVPAYGPSRGYNSYPRSLRSEGNGGSAAASAAASAAAVNPGTYKQYAVPSYELDAAR
GYEIGHGYGHRAY"
polyA_site 591
/gene="LOC6737330"
/experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN
1 gtatataggt cacgtaaatg tccaggctaa aatttgcgta taaaagcgag cgtttctggt
61 cggtaaatca tagtttgatt gattacccca aaccaacaaa actaagcact caccatgaag
121 tacctgatcg cctgtgttac cctggccctg ttcgcctaca tcaacgccag cccagcgtac
181 ggcaaccgtg gaggttatgg tggtgtctat ggtggtggct acggtggtgt tcagcgcgtc
241 gtctacgagg aggtgcccgc ctacggaccc tcccgtggct acaacagcta tccccgcagc
301 ctgcgatcgg agggtaatgg aggaagtgcc gctgcttctg ccgccgcttc cgccgctgcc
361 gtgaatcccg gaacctacaa acagtacgcc gttccctcgt acgagttgga tgccgctcgc
421 ggctatgaga tcggacatgg ctacggtcac cgtgcctact aattcccgct tcatcggcag
481 tgaattgaac tatcgactcc ttgctcaaat cctcgagtgg ctgtcatggc gaaactctga
541 gaatcagtga ataaaagcag cttgaacgca atggaaaata ccgaaaagaa a
//