Dbfetch

Dbfetch

LOCUS       XM_002084132             591 bp    mRNA    linear   INV 03-NOV-2021
DEFINITION  PREDICTED: Drosophila simulans chorion protein S15 (LOC6737330),
            mRNA.
ACCESSION   XM_002084132
VERSION     XM_002084132.4
DBLINK      BioProject: PRJNA695671
KEYWORDS    RefSeq.
SOURCE      Drosophila simulans
  ORGANISM  Drosophila simulans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_052522.2) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Nov 3, 2021 this sequence version replaced XM_002084132.3.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila simulans Annotation
                                           Release 103
            Annotation Version          :: 103
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..591
                     /organism="Drosophila simulans"
                     /mol_type="mRNA"
                     /strain="w501"
                     /db_xref="taxon:7240"
                     /chromosome="3L"
                     /sex="female"
                     /tissue_type="whole body"
                     /dev_stage="adult"
                     /collection_date="2016-12"
                     /collected_by="Erika Gajda"
     gene            1..591
                     /gene="LOC6737330"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 107 ESTs, 3 Proteins, and 100%
                     coverage of the annotated genomic feature by RNAseq
                     alignments, including 39 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:6737330"
     CDS             115..462
                     /gene="LOC6737330"
                     /codon_start=1
                     /product="chorion protein S15"
                     /protein_id="XP_002084168.1"
                     /db_xref="GeneID:6737330"
                     /translation="MKYLIACVTLALFAYINASPAYGNRGGYGGVYGGGYGGVQRVVY
                     EEVPAYGPSRGYNSYPRSLRSEGNGGSAAASAAASAAAVNPGTYKQYAVPSYELDAAR
                     GYEIGHGYGHRAY"
     polyA_site      591
                     /gene="LOC6737330"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gtatataggt cacgtaaatg tccaggctaa aatttgcgta taaaagcgag cgtttctggt
       61 cggtaaatca tagtttgatt gattacccca aaccaacaaa actaagcact caccatgaag
      121 tacctgatcg cctgtgttac cctggccctg ttcgcctaca tcaacgccag cccagcgtac
      181 ggcaaccgtg gaggttatgg tggtgtctat ggtggtggct acggtggtgt tcagcgcgtc
      241 gtctacgagg aggtgcccgc ctacggaccc tcccgtggct acaacagcta tccccgcagc
      301 ctgcgatcgg agggtaatgg aggaagtgcc gctgcttctg ccgccgcttc cgccgctgcc
      361 gtgaatcccg gaacctacaa acagtacgcc gttccctcgt acgagttgga tgccgctcgc
      421 ggctatgaga tcggacatgg ctacggtcac cgtgcctact aattcccgct tcatcggcag
      481 tgaattgaac tatcgactcc ttgctcaaat cctcgagtgg ctgtcatggc gaaactctga
      541 gaatcagtga ataaaagcag cttgaacgca atggaaaata ccgaaaagaa a
//