Dbfetch

Dbfetch

LOCUS       XM_002080629             368 bp    mRNA    linear   INV 03-NOV-2021
DEFINITION  PREDICTED: Drosophila simulans uncharacterized LOC6733611
            (LOC6733611), mRNA.
ACCESSION   XM_002080629
VERSION     XM_002080629.4
DBLINK      BioProject: PRJNA695671
KEYWORDS    RefSeq.
SOURCE      Drosophila simulans
  ORGANISM  Drosophila simulans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_052521.2) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Nov 3, 2021 this sequence version replaced XM_002080629.3.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila simulans Annotation
                                           Release 103
            Annotation Version          :: 103
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 9.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..368
                     /organism="Drosophila simulans"
                     /mol_type="mRNA"
                     /strain="w501"
                     /db_xref="taxon:7240"
                     /chromosome="2R"
                     /sex="female"
                     /tissue_type="whole body"
                     /dev_stage="adult"
                     /collection_date="2016-12"
                     /collected_by="Erika Gajda"
     gene            1..368
                     /gene="LOC6733611"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 5 ESTs, 1 Protein, and 100%
                     coverage of the annotated genomic feature by RNAseq
                     alignments"
                     /db_xref="GeneID:6733611"
     CDS             92..325
                     /gene="LOC6733611"
                     /codon_start=1
                     /product="uncharacterized protein LOC6733611"
                     /protein_id="XP_002080665.1"
                     /db_xref="GeneID:6733611"
                     /translation="MPVLEHIKAMAETPTPAGNSPAPADENAPPQAVRELTQTDHLNR
                     RLLKSLLENMQATEVLAQENGNGSNEEDNDFEE"
     polyA_site      368
                     /gene="LOC6733611"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcgagtggac ccacttagcc aagtttccaa gtgcacgagt caccctgcgg gctgtgtgtc
       61 atagcaaaag ctgatatttc tcgggggaaa aatgcctgtt ttggagcaca tcaaagccat
      121 ggccgagact ccgactccag ctgggaacag ccctgcaccg gcagacgaga atgccccgcc
      181 ccaggcagtc cgggaactga cgcagaccga tcatctcaac cgacgccttc tcaaatcgct
      241 cctggaaaac atgcaagcca ccgaggttct ggcgcaggag aacgggaacg gctccaacga
      301 ggaggacaac gatttcgaag aataaatcct tttattagag tacagtaaaa ctagtgagct
      361 aaaacgga
//