Dbfetch
LOCUS XM_002077756 914 bp mRNA linear INV 03-NOV-2021 DEFINITION PREDICTED: Drosophila simulans membrane steroid-binding protein 1 (LOC6730613), mRNA. ACCESSION XM_002077756 VERSION XM_002077756.4 DBLINK BioProject: PRJNA695671 KEYWORDS RefSeq. SOURCE Drosophila simulans ORGANISM Drosophila simulans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_052520.2) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process On Nov 3, 2021 this sequence version replaced XM_002077756.3. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila simulans Annotation Release 103 Annotation Version :: 103 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 9.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..914 /organism="Drosophila simulans" /mol_type="mRNA" /strain="w501" /db_xref="taxon:7240" /chromosome="2L" /sex="female" /tissue_type="whole body" /dev_stage="adult" /collection_date="2016-12" /collected_by="Erika Gajda" gene 1..914 /gene="LOC6730613" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 ESTs, 2 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 25 samples with support for all annotated introns" /db_xref="GeneID:6730613" CDS 129..734 /gene="LOC6730613" /codon_start=1 /product="membrane steroid-binding protein 1" /protein_id="XP_002077792.1" /db_xref="GeneID:6730613" /translation="MPILGQMFSAKLGPNLMTASKVLRSPLGQALVSFLVGYFVTTKL SQFYGKFKRDSEKSDESTQYLDKPPRADSEPKDAKGHDIVLLTLEELTAFDGSSPSLP IYTALNGLIYDLSPGREKFSSHGPYSLLAGCNANKVLNIACSSMGVCAANVIRRWEQS LRAEFQVVGYLVDAGIDIFGGSPEKHADSAKGEQTEQSDIV" polyA_site 914 /gene="LOC6730613" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 atgatcaaat tgccgctgag tttgcactcg aatatatttc gactgaacaa ctttcaaaat 61 tcatgaaatg ctgagcacaa aaacaactta aacagagcca atatatagtt tatagaaaag 121 tggtaaaaat gccgatactt ggacaaatgt tttctgcaaa gctgggtccc aatttgatga 181 cagcctccaa agtgctgaga agtcctcttg gccaggcgtt agtctccttt ttggtgggct 241 actttgtcac cacaaagttg tcgcaatttt atggcaagtt caagagggac tctgagaaat 301 ccgatgagtc gacgcagtac ttggacaaac cccccagggc ggacagtgag ccaaaagacg 361 ccaaaggaca cgatatcgtc ctgctcactc tggaggagct aactgccttc gatggctcga 421 gtcccagtct acccatctac accgctctga atggcctcat atacgatctg agtccgggcc 481 gagaaaagtt cagcagtcac ggcccctact ccctcttggc cggttgcaat gccaacaagg 541 tcctgaacat cgcctgcagt tccatgggcg tctgcgccgc gaacgtaata cgtcgctggg 601 agcagagcct aagagccgaa tttcaagtcg taggatattt agtcgatgct ggtatagata 661 tttttggcgg gagtccggaa aaacatgcag attcggccaa aggggagcaa acggagcaga 721 gtgatatcgt ttgagatgct gtgaatatcc cgttttctta gcttggcaat aaaatattat 781 tcacagaaac tagtaattta cttccaagct aactgaaggg aattattcag tgcaacatcg 841 gactaaaaat gctttttgga aaaattacat gtaacttgta gcttaagctg tagaataaac 901 taaattatta aaga //