Dbfetch
LOCUS NM_126112 848 bp mRNA linear PLN 20-OCT-2022 DEFINITION Arabidopsis thaliana RING/U-box superfamily protein (AT5G67120), mRNA. ACCESSION NM_126112 VERSION NM_126112.2 DBLINK BioProject: PRJNA116 BioSample: SAMN03081427 KEYWORDS RefSeq. SOURCE Arabidopsis thaliana (thale cress) ORGANISM Arabidopsis thaliana Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis. REFERENCE 1 (bases 1 to 848) AUTHORS Tabata,S., Kaneko,T., Nakamura,Y., Kotani,H., Kato,T., Asamizu,E., Miyajima,N., Sasamoto,S., Kimura,T., Hosouchi,T., Kawashima,K., Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S., Nakazaki,N., Naruo,K., Okumura,S., Shinpo,S., Takeuchi,C., Wada,T., Watanabe,A., Yamada,M., Yasuda,M., Sato,S., de la Bastide,M., Huang,E., Spiegel,L., Gnoj,L., O'Shaughnessy,A., Preston,R., Habermann,K., Murray,J., Johnson,D., Rohlfing,T., Nelson,J., Stoneking,T., Pepin,K., Spieth,J., Sekhon,M., Armstrong,J., Becker,M., Belter,E., Cordum,H., Cordes,M., Courtney,L., Courtney,W., Dante,M., Du,H., Edwards,J., Fryman,J., Haakensen,B., Lamar,E., Latreille,P., Leonard,S., Meyer,R., Mulvaney,E., Ozersky,P., Riley,A., Strowmatt,C., Wagner-McPherson,C., Wollam,A., Yoakum,M., Bell,M., Dedhia,N., Parnell,L., Shah,R., Rodriguez,M., See,L.H., Vil,D., Baker,J., Kirchoff,K., Toth,K., King,L., Bahret,A., Miller,B., Marra,M., Martienssen,R., McCombie,W.R., Wilson,R.K., Murphy,G., Bancroft,I., Volckaert,G., Wambutt,R., Dusterhoft,A., Stiekema,W., Pohl,T., Entian,K.D., Terryn,N., Hartley,N., Bent,E., Johnson,S., Langham,S.A., McCullagh,B., Robben,J., Grymonprez,B., Zimmermann,W., Ramsperger,U., Wedler,H., Balke,K., Wedler,E., Peters,S., van Staveren,M., Dirkse,W., Mooijman,P., Lankhorst,R.K., Weitzenegger,T., Bothe,G., Rose,M., Hauf,J., Berneiser,S., Hempel,S., Feldpausch,M., Lamberth,S., Villarroel,R., Gielen,J., Ardiles,W., Bents,O., Lemcke,K., Kolesov,G., Mayer,K., Rudd,S., Schoof,H., Schueller,C., Zaccaria,P., Mewes,H.W., Bevan,M. and Fransz,P. CONSRTM Kazusa DNA Research Institute; Cold Spring Harbor and Washington University in St Louis Sequencing Consortium; European Union Arabidopsis Genome Sequencing Consortium TITLE Sequence and analysis of chromosome 5 of the plant Arabidopsis thaliana JOURNAL Nature 408 (6814), 823-826 (2000) PUBMED 11130714 REFERENCE 2 (bases 1 to 848) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 848) AUTHORS Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M., Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R., Vaughn,M. and Town,C.D. TITLE Direct Submission JOURNAL Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute, 9704 Medical Center Dr, Rockville, MD 20850, USA REMARK Protein update by submitter REFERENCE 4 (bases 1 to 848) AUTHORS Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E. CONSRTM TAIR TITLE Direct Submission JOURNAL Submitted (18-FEB-2011) Department of Plant Biology, Carnegie Institution, 260 Panama Street, Stanford, CA, USA COMMENT REVIEWED REFSEQ: This record has been curated by TAIR and Araport. This record is derived from an annotated genomic sequence (NC_003076). On Sep 12, 2016 this sequence version replaced NM_126112.1. FEATURES Location/Qualifiers source 1..848 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="5" /ecotype="Columbia" gene 1..848 /locus_tag="AT5G67120" /gene_synonym="K21H1.8; K21H1_8" /db_xref="Araport:AT5G67120" /db_xref="GeneID:836847" /db_xref="TAIR:AT5G67120" CDS 9..827 /locus_tag="AT5G67120" /gene_synonym="K21H1.8; K21H1_8" /note="RING/U-box superfamily protein; FUNCTIONS IN: zinc ion binding; CONTAINS InterPro DOMAIN/s: Zinc finger, RING-type (InterPro:IPR001841), Zinc finger, C3HC4 RING-type (InterPro:IPR018957); BEST Arabidopsis thaliana protein match is: RING/U-box superfamily protein (TAIR:AT4G34040.1); Has 1807 Blast hits to 1807 proteins in 277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink)." /codon_start=1 /product="RING/U-box superfamily protein" /protein_id="NP_201513.1" /db_xref="GeneID:836847" /db_xref="TAIR:AT5G67120" /db_xref="Araport:AT5G67120" /translation="MDPNEDNSEIPDSPFSFMWLLFGDDWDLWDTYSPVDADDISPDP TLDVNGDGPAIEPGSLLRTISWETTFEQDSLQSWNDEQSETTSVVEYTDVSSHGNTFT NEEETLERYWRNWLQSSTNEQSETGSQEEYTNASSHGGTFIYEEETLEQYWRNWLQSS TNEQFETESLEEYTNPSSHGDIFTYEELLSITDETGDERTGLSEEVIDENLIRRKYEK RSDDETKRCVICQQKLKDNEEVSKLGCGHDFHFGCIKNWLMVTNKCPLCNREVV" ORIGIN 1 ccaaaagtat ggatccaaac gaagacaatt ctgagatacc ggatagtcct tttagcttca 61 tgtggctact atttggagac gactgggatc tatgggacac ttactcacca gttgatgctg 121 atgacatctc accagatcca acgcttgatg tgaacggtga tggtccggca atagagcccg 181 gttcccttct gaggacaatt agttgggaaa caacgttcga gcaggactcg ttacaatcat 241 ggaacgatga acaatctgaa acaacatcag tagtagagta tacagatgta tcttctcatg 301 gaaacacctt cactaacgag gaagaaacgt tggagcgtta ctggagaaac tggttacagt 361 catcgaccaa tgaacaatct gaaacaggat cacaagaaga gtatacaaat gcatcttctc 421 atggaggcac cttcatttac gaggaagaaa cgttggagca gtattggaga aactggttac 481 agtcatcgac aaatgaacaa tttgaaacag agtcactaga agagtataca aatccatctt 541 ctcatggaga catcttcact tacgaggaat tattgagcat cactgacgaa acaggagatg 601 aacgcactgg tttaagcgag gaagtgattg atgagaatct aataagaagg aaatatgaaa 661 agcgtagcga cgatgaaacg aagagatgtg tgatctgtca gcagaaattg aaggacaatg 721 aagaagtttc gaaactggga tgtgggcatg actttcactt cggatgcatc aagaattggc 781 taatggtcac gaacaagtgt cctctttgca accgagaagt cgtttaaatg ttttatcaag 841 tttgaaag //