Dbfetch
LOCUS NM_116388 740 bp mRNA linear PLN 20-OCT-2022 DEFINITION Arabidopsis thaliana serine protease inhibitor, Kazal-type family protein (AT4G01575), mRNA. ACCESSION NM_116388 VERSION NM_116388.2 DBLINK BioProject: PRJNA116 BioSample: SAMN03081427 KEYWORDS RefSeq. SOURCE Arabidopsis thaliana (thale cress) ORGANISM Arabidopsis thaliana Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis. REFERENCE 1 (bases 1 to 740) AUTHORS Mayer,K., Schuller,C., Wambutt,R., Murphy,G., Volckaert,G., Pohl,T., Dusterhoft,A., Stiekema,W., Entian,K.D., Terryn,N., Harris,B., Ansorge,W., Brandt,P., Grivell,L., Rieger,M., Weichselgartner,M., de Simone,V., Obermaier,B., Mache,R., Muller,M., Kreis,M., Delseny,M., Puigdomenech,P., Watson,M., Schmidtheini,T., Reichert,B., Portatelle,D., Perez-Alonso,M., Boutry,M., Bancroft,I., Vos,P., Hoheisel,J., Zimmermann,W., Wedler,H., Ridley,P., Langham,S.A., McCullagh,B., Bilham,L., Robben,J., Van der Schueren,J., Grymonprez,B., Chuang,Y.J., Vandenbussche,F., Braeken,M., Weltjens,I., Voet,M., Bastiaens,I., Aert,R., Defoor,E., Weitzenegger,T., Bothe,G., Ramsperger,U., Hilbert,H., Braun,M., Holzer,E., Brandt,A., Peters,S., van Staveren,M., Dirske,W., Mooijman,P., Klein Lankhorst,R., Rose,M., Hauf,J., Kotter,P., Berneiser,S., Hempel,S., Feldpausch,M., Lamberth,S., Van den Daele,H., De Keyser,A., Buysshaert,C., Gielen,J., Villarroel,R., De Clercq,R., Van Montagu,M., Rogers,J., Cronin,A., Quail,M., Bray-Allen,S., Clark,L., Doggett,J., Hall,S., Kay,M., Lennard,N., McLay,K., Mayes,R., Pettett,A., Rajandream,M.A., Lyne,M., Benes,V., Rechmann,S., Borkova,D., Blocker,H., Scharfe,M., Grimm,M., Lohnert,T.H., Dose,S., de Haan,M., Maarse,A., Schafer,M., Muller-Auer,S., Gabel,C., Fuchs,M., Fartmann,B., Granderath,K., Dauner,D., Herzl,A., Neumann,S., Argiriou,A., Vitale,D., Liguori,R., Piravandi,E., Massenet,O., Quigley,F., Clabauld,G., Mundlein,A., Felber,R., Schnabl,S., Hiller,R., Schmidt,W., Lecharny,A., Aubourg,S., Chefdor,F., Cooke,R., Berger,C., Montfort,A., Casacuberta,E., Gibbons,T., Weber,N., Vandenbol,M., Bargues,M., Terol,J., Torres,A., Perez-Perez,A., Purnelle,B., Bent,E., Johnson,S., Tacon,D., Jesse,T., Heijnen,L., Schwarz,S., Scholler,P., Heber,S., Francs,P., Bielke,C., Frishman,D., Haase,D., Lemcke,K., Mewes,H.W., Stocker,S., Zaccaria,P., Bevan,M., Wilson,R.K., de la Bastide,M., Habermann,K., Parnell,L., Dedhia,N., Gnoj,L., Schutz,K., Huang,E., Spiegel,L., Sehkon,M., Murray,J., Sheet,P., Cordes,M., Abu-Threideh,J., Stoneking,T., Kalicki,J., Graves,T., Harmon,G., Edwards,J., Latreille,P., Courtney,L., Cloud,J., Abbott,A., Scott,K., Johnson,D., Minx,P., Bentley,D., Fulton,B., Miller,N., Greco,T., Kemp,K., Kramer,J., Fulton,L., Mardis,E., Dante,M., Pepin,K., Hillier,L., Nelson,J., Spieth,J., Ryan,E., Andrews,S., Geisel,C., Layman,D., Du,H., Ali,J., Berghoff,A., Jones,K., Drone,K., Cotton,M., Joshu,C., Antonoiu,B., Zidanic,M., Strong,C., Sun,H., Lamar,B., Yordan,C., Ma,P., Zhong,J., Preston,R., Vil,D., Shekher,M., Matero,A., Shah,R., Swaby,I.K., O'Shaughnessy,A., Rodriguez,M., Hoffmann,J., Till,S., Granat,S., Shohdy,N., Hasegawa,A., Hameed,A., Lodhi,M., Johnson,A., Chen,E., Marra,M., Martienssen,R. and McCombie,W.R. TITLE Sequence and analysis of chromosome 4 of the plant Arabidopsis thaliana JOURNAL Nature 402 (6763), 769-777 (1999) PUBMED 10617198 REFERENCE 2 (bases 1 to 740) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 740) AUTHORS Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M., Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R., Vaughn,M. and Town,C.D. TITLE Direct Submission JOURNAL Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute, 9704 Medical Center Dr, Rockville, MD 20850, USA REMARK Protein update by submitter REFERENCE 4 (bases 1 to 740) AUTHORS Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E. CONSRTM TAIR TITLE Direct Submission JOURNAL Submitted (18-FEB-2011) Department of Plant Biology, Carnegie Institution, 260 Panama Street, Stanford, CA, USA COMMENT REVIEWED REFSEQ: This record has been curated by TAIR and Araport. This record is derived from an annotated genomic sequence (NC_003075). On Apr 18, 2007 this sequence version replaced NM_116388.1. FEATURES Location/Qualifiers source 1..740 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="4" /ecotype="Columbia" gene 1..740 /locus_tag="AT4G01575" /gene_synonym="T15B16.19; T15B16_19" /db_xref="Araport:AT4G01575" /db_xref="GeneID:828124" /db_xref="TAIR:AT4G01575" CDS 128..562 /locus_tag="AT4G01575" /gene_synonym="T15B16.19; T15B16_19" /inference="Similar to RNA sequence, EST:INSD:EL011210.1,INSD:AV793165.1,INSD:AI995499.1, INSD:DR328350.1,INSD:EL257817.1,INSD:ES077218.1, INSD:AV552716.1,INSD:AI996294.1,INSD:ES196418.1, INSD:DR374430.1,INSD:ES175197.1,INSD:ES148554.1, INSD:DR328348.1,INSD:DR328349.1,INSD:EL235834.1" /inference="Similar to RNA sequence, mRNA:INSD:AY086883.1,INSD:BX821774.1" /note="serine protease inhibitor, Kazal-type family protein; FUNCTIONS IN: serine-type endopeptidase inhibitor activity; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; BEST Arabidopsis thaliana protein match is: serine protease inhibitor, Kazal-type family protein (TAIR:AT3G61980.1); Has 54 Blast hits to 54 proteins in 12 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 54; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink)." /codon_start=1 /product="serine protease inhibitor, Kazal-type family protein" /protein_id="NP_567214.1" /db_xref="GeneID:828124" /db_xref="TAIR:AT4G01575" /db_xref="Araport:AT4G01575" /translation="MKFKIRISAMSTISPSLAVIAFLFLILLNLSSVFADPSTEGGEI IRLPSEKINGEKNRGEFCEGIAKPASCPVQCFRPDPVCGEDSVTYWCGCADALCHGVR VVKQGACDVGNGVGLSVPGQALLLIHIVWMMLLGFSILFGLF" ORIGIN 1 ctttcaggaa aagagaggaa acaacgtttc gtcttctcag attctttacc tttcttaagg 61 aaaaatccca aaagagagaa gataaaaatc tcgcattcag attttagggt ttctgacaaa 121 ttctccgatg aaattcaaga tccgaatctc ggcaatgtcg acaatctcgc cgtcattagc 181 cgtaattgcg tttctttttc tgattcttct gaatctatct tcggttttcg ctgatccttc 241 gacggaagga ggagagatta ttaggttacc ttcggagaag atcaacggtg aaaaaaacag 301 aggcgaattc tgtgaaggaa ttgctaaacc ggcttcgtgt ccggttcagt gtttcaggcc 361 tgatccggtt tgcggtgaag acagcgttac ttactggtgc ggttgtgcag atgctttgtg 421 ccatggtgtt cgtgttgtga aacaaggagc ttgtgatgtt ggtaatggtg ttggtttgtc 481 tgttcctgga caagctctgc ttttgataca cattgtctgg atgatgcttc ttgggttttc 541 tattctcttt gggctctttt gattttggtt ctaatttctc tgaatcaaaa caacatatag 601 aagattgttt aggttttcag attgcaaatg acgaatcttt tttgtttata ctcttctttt 661 tttctttata ttgctctgta ttcatattac attaaaacta tgaggaaata ttattattat 721 ttggtttgtt tcgtacaaaa //