Dbfetch
LOCUS NM_105985 1185 bp mRNA linear PLN 20-OCT-2022 DEFINITION Arabidopsis thaliana kunitz trypsin inhibitor 1 (KTI1), mRNA. ACCESSION NM_105985 VERSION NM_105985.3 DBLINK BioProject: PRJNA116 BioSample: SAMN03081427 KEYWORDS RefSeq. SOURCE Arabidopsis thaliana (thale cress) ORGANISM Arabidopsis thaliana Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis. REFERENCE 1 (bases 1 to 1185) AUTHORS Theologis,A., Ecker,J.R., Palm,C.J., Federspiel,N.A., Kaul,S., White,O., Alonso,J., Altafi,H., Araujo,R., Bowman,C.L., Brooks,S.Y., Buehler,E., Chan,A., Chao,Q., Chen,H., Cheuk,R.F., Chin,C.W., Chung,M.K., Conn,L., Conway,A.B., Conway,A.R., Creasy,T.H., Dewar,K., Dunn,P., Etgu,P., Feldblyum,T.V., Feng,J., Fong,B., Fujii,C.Y., Gill,J.E., Goldsmith,A.D., Haas,B., Hansen,N.F., Hughes,B., Huizar,L., Hunter,J.L., Jenkins,J., Johnson-Hopson,C., Khan,S., Khaykin,E., Kim,C.J., Koo,H.L., Kremenetskaia,I., Kurtz,D.B., Kwan,A., Lam,B., Langin-Hooper,S., Lee,A., Lee,J.M., Lenz,C.A., Li,J.H., Li,Y., Lin,X., Liu,S.X., Liu,Z.A., Luros,J.S., Maiti,R., Marziali,A., Militscher,J., Miranda,M., Nguyen,M., Nierman,W.C., Osborne,B.I., Pai,G., Peterson,J., Pham,P.K., Rizzo,M., Rooney,T., Rowley,D., Sakano,H., Salzberg,S.L., Schwartz,J.R., Shinn,P., Southwick,A.M., Sun,H., Tallon,L.J., Tambunga,G., Toriumi,M.J., Town,C.D., Utterback,T., Van Aken,S., Vaysberg,M., Vysotskaia,V.S., Walker,M., Wu,D., Yu,G., Fraser,C.M., Venter,J.C. and Davis,R.W. TITLE Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana JOURNAL Nature 408 (6814), 816-820 (2000) PUBMED 11130712 REFERENCE 2 (bases 1 to 1185) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 1185) AUTHORS Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M., Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R., Vaughn,M. and Town,C.D. TITLE Direct Submission JOURNAL Submitted (18-JUL-2017) Plant Genomics, J. Craig Venter Institute, 9704 Medical Center Dr, Rockville, MD 20850, USA REMARK Protein update by submitter REFERENCE 4 (bases 1 to 1185) AUTHORS Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M., Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R., Vaughn,M. and Town,C.D. TITLE Direct Submission JOURNAL Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute, 9704 Medical Center Dr, Rockville, MD 20850, USA REMARK Protein update by submitter REFERENCE 5 (bases 1 to 1185) AUTHORS Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E. CONSRTM TAIR TITLE Direct Submission JOURNAL Submitted (18-FEB-2011) Department of Plant Biology, Carnegie Institution, 260 Panama Street, Stanford, CA, USA COMMENT REVIEWED REFSEQ: This record has been curated by TAIR and Araport. This record is derived from an annotated genomic sequence (NC_003070). On Sep 12, 2016 this sequence version replaced NM_105985.2. FEATURES Location/Qualifiers source 1..1185 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="1" /ecotype="Columbia" gene 1..1185 /gene="KTI1" /locus_tag="AT1G73260" /gene_synonym="ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1; ATKTI1; kunitz trypsin inhibitor 1; T18K17.7; T18K17_7" /note="Encodes a trypsin inhibitor involved in modulating programmed cell death in plant-pathogen interactions." /db_xref="Araport:AT1G73260" /db_xref="GeneID:843660" /db_xref="TAIR:AT1G73260" CDS 226..873 /gene="KTI1" /locus_tag="AT1G73260" /gene_synonym="ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1; ATKTI1; kunitz trypsin inhibitor 1; T18K17.7; T18K17_7" /inference="Similar to RNA sequence, EST:INSD:CD531230.1,INSD:R30257.1,INSD:CD529731.1, INSD:DR260154.1,INSD:BP866707.1,INSD:BP806281.1, INSD:BP599497.1,INSD:CD531025.1,INSD:BP863033.1, INSD:CD534798.1,INSD:EG428536.1,INSD:CD534156.1, INSD:AI998304.1,INSD:EL130403.1,INSD:BP799944.1, INSD:BP611124.1,INSD:BP605661.1,INSD:CD530905.1, INSD:EL206037.1,INSD:EL312935.1,INSD:BP807159.1, INSD:BP621645.1,INSD:BP808993.1,INSD:BP616239.1, INSD:CD531695.1,INSD:DR375812.1,INSD:EL048177.1, INSD:DR260152.1,INSD:BP588639.1,INSD:AV785054.1, INSD:AV788475.1,INSD:EL291026.1,INSD:CD534650.1, INSD:BP620595.1,INSD:N38333.1,INSD:BP804411.1, INSD:EG480836.1,INSD:BP602567.1,INSD:EG516137.1, INSD:DR260155.1,INSD:DR260153.1,INSD:DR260151.1, INSD:EL257972.1,INSD:AV823955.1,INSD:BP618700.1, INSD:BP599811.1,INSD:EG428004.1,INSD:CD533576.1, INSD:EG428537.1,INSD:AV819408.1,INSD:CD534966.1, INSD:BP806107.1,INSD:EG516057.1,INSD:EH927385.1, INSD:EH888196.1,INSD:BP611252.1,INSD:AV786855.1, INSD:EL332609.1,INSD:BP601388.1,INSD:DR260148.1, INSD:CD532420.1,INSD:CD529945.1,INSD:BP610077.1, INSD:BP622462.1,INSD:EG480857.1,INSD:AV832159.1, INSD:AV545497.1,INSD:DR260149.1,INSD:CD534735.1, INSD:CD530272.1,INSD:BP618978.1,INSD:BP610852.1, INSD:EG502795.1,INSD:CD531716.1,INSD:DR260150.1" /inference="similar to RNA sequence, mRNA:INSD:BT000366.1,INSD:AY081323.1,INSD:AY054566.1, INSD:BX818097.1,INSD:BT002548.1" /note="kunitz trypsin inhibitor 1 (KTI1); FUNCTIONS IN: endopeptidase inhibitor activity; INVOLVED IN: response to salt stress, response to hydrogen peroxide, defense response to bacterium, programmed cell death, response to salicylic acid stimulus; LOCATED IN: mitochondrion; EXPRESSED IN: 8 plant structures; EXPRESSED DURING: LP.06 six leaves visible, LP.04 four leaves visible, 4 anthesis, petal differentiation and expansion stage; CONTAINS InterPro DOMAIN/s: Proteinase inhibitor I3, Kunitz legume (InterPro:IPR002160), Kunitz inhibitor ST1-like (InterPro:IPR011065); BEST Arabidopsis thaliana protein match is: Kunitz family trypsin and protease inhibitor protein (TAIR:AT1G17860.1); Has 626 Blast hits to 626 proteins in 98 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 625; Viruses - 0; Other Eukaryotes - 1 (source: NCBI BLink)." /codon_start=1 /product="kunitz trypsin inhibitor 1" /protein_id="NP_565061.1" /db_xref="Araport:AT1G73260" /db_xref="GeneID:843660" /db_xref="TAIR:AT1G73260" /translation="MTKTTKTMNPKFYLVLALTAVLASNAYGAVVDIDGNAMFHESYY VLPVIRGRGGGLTLAGRGGQPCPYDIVQESSEVDEGIPVKFSNWRLKVAFVPESQNLN IETDVGATICIQSTYWRVGEFDHERKQYFVVAGPKPEGFGQDSLKSFFKIEKSGEDAY KFVFCPRTCDSGNPKCSDVGIFIDELGVRRLALSDKPFLVMFKKANVTEVSSKTM" ORIGIN 1 gtagaatgtt cgtagatatg atcatgatca tcttctcaat gtgtagtatg cttaaattca 61 tataaatatt gagagtttaa agttcacaag ctaagcatac actagctatc aagccgcctc 121 acctactctc caatatccat tggaataatc atacttacgt gtttataaat aagtattaca 181 tcaacccata tcttcttcat ccacaaataa ccattggcta taattatgac aaaaactacc 241 aaaaccatga atcctaagtt ttacttggtt cttgccttaa ccgcggttct ggcctcaaac 301 gcatatggtg cggttgtaga catcgatgga aacgccatgt tccacgaaag ttactacgtt 361 ctccctgtca tccgtggccg aggcggaggc ctgactctag caggccgcgg tgggcagcca 421 tgtccttacg atatcgtgca ggaatcttca gaagttgatg agggcattcc cgtaaaattc 481 tcaaactgga ggcttaaggt tgcgttcgtt cccgaatcac agaacctcaa catcgaaaca 541 gacgtcggag ccacgatctg catccagtca acctactggc gggtcggtga gtttgaccac 601 gagaggaagc agtacttcgt ggttgctggt ccaaagccag aagggttcgg acaagattcg 661 ttgaagagtt tcttcaagat cgagaaatct ggagaggatg cttacaagtt tgtgttctgt 721 cctcggactt gcgactctgg caatccaaaa tgcagcgatg tcgggatatt catagatgaa 781 cttggcgttc gtcgtttggc tttaagcgat aagccgttct tggttatgtt caaaaaagct 841 aatgtgaccg aagtttcgtc caagactatg tgagaggaca actctcgatc ttttactttg 901 actactcata ataaaacctc tatgtttttt ttttgataaa acacccgctc tctgttttct 961 tgaaaactac aaattgaata aaagctagtg aagcacatgc ctatttatta aatcttcatc 1021 ttctctcaat cttaatgccc gatataaatc aaagggatag agtggacgtc catttaaata 1081 aaaccagcta acaatacaag cccctaatta ttgttgtgta tttaataaga aaaaggaagc 1141 ttttaaacag tacccgttct ctagagaatt ctgatgatgg tagtg //