Dbfetch

LOCUS       NM_074312               1321 bp    mRNA    linear   INV 22-NOV-2023
DEFINITION  Caenorhabditis elegans putative tRNA N6-adenosine
            threonylcarbamoyltransferase, mitochondrial (C01G10.10), mRNA.
ACCESSION   NM_074312
VERSION     NM_074312.7
DBLINK      BioProject: PRJNA158
KEYWORDS    RefSeq.
SOURCE      Caenorhabditis elegans
  ORGANISM  Caenorhabditis elegans
            Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
            Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
            Caenorhabditis.
REFERENCE   1  (bases 1 to 1321)
  AUTHORS   Sulson,J.E. and Waterston,R.
  CONSRTM   Caenorhabditis elegans Sequencing Consortium
  TITLE     Genome sequence of the nematode C. elegans: a platform for
            investigating biology
  JOURNAL   Science 282 (5396), 2012-2018 (1998)
   PUBMED   9851916
  REMARK    Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE   2  (bases 1 to 1321)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (22-NOV-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1321)
  AUTHORS   WormBase.
  CONSRTM   WormBase Consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (29-OCT-2023) WormBase Group, European Bioinformatics
            Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE   4  (bases 1 to 1321)
  AUTHORS   Sulson,J.E. and Waterston,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
            Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
            at Washington University, St. Louis, MO 63110, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by WormBase. This
            record is derived from an annotated genomic sequence (NC_003283).
            
            On Feb 2, 2021 this sequence version replaced NM_074312.6.
FEATURES             Location/Qualifiers
     source          1..1321
                     /organism="Caenorhabditis elegans"
                     /mol_type="mRNA"
                     /strain="Bristol N2"
                     /db_xref="taxon:6239"
                     /chromosome="V"
     gene            1..1321
                     /gene="C01G10.10"
                     /locus_tag="CELE_C01G10.10"
                     /db_xref="GeneID:180015"
                     /db_xref="WormBase:WBGene00007237"
     CDS             22..1287
                     /gene="C01G10.10"
                     /locus_tag="CELE_C01G10.10"
                     /standard_name="C01G10.10a"
                     /note="Confirmed by transcript evidence"
                     /codon_start=1
                     /product="putative tRNA N6-adenosine
                     threonylcarbamoyltransferase, mitochondrial"
                     /protein_id="NP_506713.1"
                     /db_xref="EnsemblGenomes-Gn:WBGene00007237"
                     /db_xref="EnsemblGenomes-Tr:C01G10.10a"
                     /db_xref="GeneID:180015"
                     /db_xref="WormBase:WBGene00007237"
                     /translation="MNIPKILNNNLVLKRIFCRNYSVKVLGIETSCDDTAVAIVNEKR
                     EILSSERYTERAIQRQQGGINPSVCALQHRENLPRLIEKCLNDAGTSPKDLDAVAVTV
                     TPGLVIALKEGISAAIGFAKKHRLPLIPVHHMRAHALSILLVDDSVRFPFSAVLLSGG
                     HALISVAEDVEKFKLYGQSVSGSPGECIDKVARQLGDLGSEFDGIHVGAAVEILASRA
                     SADGHLRYPIFLPNVPKANMNFDQIKGSYLNLLERLRKNSETSIDIPDFCASLQNTVA
                     RHISSKLHIFFESLSEQEKLPKQLVIGGGVAANQYIFGAISKLSAAHNVTTIKVLLSL
                     CTDNAEMIAYSGLLMLVNRSEAIWWRPNDIPDTIYAHARSDIGTDASSEIIDTPRRKL
                     VTSTIHGTERIRFRNLDDFKKPKSPKTTE"
ORIGIN      
        1 tattcaattt ctccatctaa aatgaatatt ccgaaaattc tgaacaacaa tttagtttta
       61 aagcgaattt tttgtcgaaa ttactccgtt aaagtgctag gaattgaaac aagttgtgac
      121 gatactgcag tagcaattgt caacgagaaa cgagagattt tatcttcaga gcggtacaca
      181 gaacgggcga ttcagagaca acaaggcggg attaatcctt cagtctgcgc acttcaacac
      241 cgtgagaacc ttccaaggct tatagaaaag tgtctgaacg acgctggaac atcaccgaaa
      301 gatctggatg cagtagcggt tacagtaacg cctggattag ttattgcact taaagaggga
      361 atttcagcgg cgattggatt tgcaaaaaaa catcgtcttc cactgattcc agttcatcat
      421 atgagagccc atgctctgtc aattcttctc gtcgatgatt cagtgcgatt tccattttca
      481 gcagttcttc tttcgggtgg tcatgcattg atttctgttg cagaagatgt cgagaaattc
      541 aaattgtacg gccaaagtgt cagtggaagc ccgggcgagt gcattgacaa agttgcgcgg
      601 cagcttggag atcttggatc agaattcgat gggattcatg tgggcgctgc ggtggaaatt
      661 ctagcctcta gagcctctgc tgatggccat ttgagatatc ccatatttct tccaaacgtt
      721 ccaaaagcta atatgaactt cgatcaaatc aaaggatcct atctgaattt gctggaaaga
      781 ttgagaaaaa actctgaaac atcaattgat attccagatt tttgtgctag ccttcagaac
      841 accgtagccc gacatatctc gagcaaactt cacatcttct tcgaaagtct ctccgagcag
      901 gaaaaacttc caaaacagct ggtgatcggc ggcggagtgg cggcgaatca gtacattttt
      961 ggagcaatct caaaactatc agctgctcac aatgtcacaa ccatcaaagt cctcttgtcc
     1021 ctttgcacag acaatgccga aatgatcgcc tacagtggcc ttctgatgct cgtcaatcga
     1081 tcggaggcaa tttggtggcg accgaatgac attcctgaca caatttatgc acacgctaga
     1141 agcgatattg ggacggatgc ttcttcggaa atcattgata caccgcgtcg gaaactggtg
     1201 acatccacga tccatggcac cgagcggata cgattccgga atctggatga ttttaagaag
     1261 cctaaaagcc ctaaaacaac tgaatgaaga aaattttcta ataaaaaatg cacataattt
     1321 t
//