Dbfetch
LOCUS NM_074312 1321 bp mRNA linear INV 22-NOV-2023
DEFINITION Caenorhabditis elegans putative tRNA N6-adenosine
threonylcarbamoyltransferase, mitochondrial (C01G10.10), mRNA.
ACCESSION NM_074312
VERSION NM_074312.7
DBLINK BioProject: PRJNA158
KEYWORDS RefSeq.
SOURCE Caenorhabditis elegans
ORGANISM Caenorhabditis elegans
Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae;
Caenorhabditis.
REFERENCE 1 (bases 1 to 1321)
AUTHORS Sulson,J.E. and Waterston,R.
CONSRTM Caenorhabditis elegans Sequencing Consortium
TITLE Genome sequence of the nematode C. elegans: a platform for
investigating biology
JOURNAL Science 282 (5396), 2012-2018 (1998)
PUBMED 9851916
REMARK Erratum:[Science 1999 Jan 1;283(5398):35]
REFERENCE 2 (bases 1 to 1321)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (22-NOV-2023) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 1321)
AUTHORS WormBase.
CONSRTM WormBase Consortium
TITLE Direct Submission
JOURNAL Submitted (29-OCT-2023) WormBase Group, European Bioinformatics
Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org
REFERENCE 4 (bases 1 to 1321)
AUTHORS Sulson,J.E. and Waterston,R.
TITLE Direct Submission
JOURNAL Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger
Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute
at Washington University, St. Louis, MO 63110, USA
COMMENT REVIEWED REFSEQ: This record has been curated by WormBase. This
record is derived from an annotated genomic sequence (NC_003283).
On Feb 2, 2021 this sequence version replaced NM_074312.6.
FEATURES Location/Qualifiers
source 1..1321
/organism="Caenorhabditis elegans"
/mol_type="mRNA"
/strain="Bristol N2"
/db_xref="taxon:6239"
/chromosome="V"
gene 1..1321
/gene="C01G10.10"
/locus_tag="CELE_C01G10.10"
/db_xref="GeneID:180015"
/db_xref="WormBase:WBGene00007237"
CDS 22..1287
/gene="C01G10.10"
/locus_tag="CELE_C01G10.10"
/standard_name="C01G10.10a"
/note="Confirmed by transcript evidence"
/codon_start=1
/product="putative tRNA N6-adenosine
threonylcarbamoyltransferase, mitochondrial"
/protein_id="NP_506713.1"
/db_xref="EnsemblGenomes-Gn:WBGene00007237"
/db_xref="EnsemblGenomes-Tr:C01G10.10a"
/db_xref="GeneID:180015"
/db_xref="WormBase:WBGene00007237"
/translation="MNIPKILNNNLVLKRIFCRNYSVKVLGIETSCDDTAVAIVNEKR
EILSSERYTERAIQRQQGGINPSVCALQHRENLPRLIEKCLNDAGTSPKDLDAVAVTV
TPGLVIALKEGISAAIGFAKKHRLPLIPVHHMRAHALSILLVDDSVRFPFSAVLLSGG
HALISVAEDVEKFKLYGQSVSGSPGECIDKVARQLGDLGSEFDGIHVGAAVEILASRA
SADGHLRYPIFLPNVPKANMNFDQIKGSYLNLLERLRKNSETSIDIPDFCASLQNTVA
RHISSKLHIFFESLSEQEKLPKQLVIGGGVAANQYIFGAISKLSAAHNVTTIKVLLSL
CTDNAEMIAYSGLLMLVNRSEAIWWRPNDIPDTIYAHARSDIGTDASSEIIDTPRRKL
VTSTIHGTERIRFRNLDDFKKPKSPKTTE"
ORIGIN
1 tattcaattt ctccatctaa aatgaatatt ccgaaaattc tgaacaacaa tttagtttta
61 aagcgaattt tttgtcgaaa ttactccgtt aaagtgctag gaattgaaac aagttgtgac
121 gatactgcag tagcaattgt caacgagaaa cgagagattt tatcttcaga gcggtacaca
181 gaacgggcga ttcagagaca acaaggcggg attaatcctt cagtctgcgc acttcaacac
241 cgtgagaacc ttccaaggct tatagaaaag tgtctgaacg acgctggaac atcaccgaaa
301 gatctggatg cagtagcggt tacagtaacg cctggattag ttattgcact taaagaggga
361 atttcagcgg cgattggatt tgcaaaaaaa catcgtcttc cactgattcc agttcatcat
421 atgagagccc atgctctgtc aattcttctc gtcgatgatt cagtgcgatt tccattttca
481 gcagttcttc tttcgggtgg tcatgcattg atttctgttg cagaagatgt cgagaaattc
541 aaattgtacg gccaaagtgt cagtggaagc ccgggcgagt gcattgacaa agttgcgcgg
601 cagcttggag atcttggatc agaattcgat gggattcatg tgggcgctgc ggtggaaatt
661 ctagcctcta gagcctctgc tgatggccat ttgagatatc ccatatttct tccaaacgtt
721 ccaaaagcta atatgaactt cgatcaaatc aaaggatcct atctgaattt gctggaaaga
781 ttgagaaaaa actctgaaac atcaattgat attccagatt tttgtgctag ccttcagaac
841 accgtagccc gacatatctc gagcaaactt cacatcttct tcgaaagtct ctccgagcag
901 gaaaaacttc caaaacagct ggtgatcggc ggcggagtgg cggcgaatca gtacattttt
961 ggagcaatct caaaactatc agctgctcac aatgtcacaa ccatcaaagt cctcttgtcc
1021 ctttgcacag acaatgccga aatgatcgcc tacagtggcc ttctgatgct cgtcaatcga
1081 tcggaggcaa tttggtggcg accgaatgac attcctgaca caatttatgc acacgctaga
1141 agcgatattg ggacggatgc ttcttcggaa atcattgata caccgcgtcg gaaactggtg
1201 acatccacga tccatggcac cgagcggata cgattccgga atctggatga ttttaagaag
1261 cctaaaagcc ctaaaacaac tgaatgaaga aaattttcta ataaaaaatg cacataattt
1321 t
//