Dbfetch
LOCUS NM_001313255 759 bp mRNA linear INV 22-NOV-2023 DEFINITION Caenorhabditis elegans SXP/RAL-2 family protein Ani s 5-like cation-binding domain-containing protein (srlf-23), partial mRNA. ACCESSION NM_001313255 VERSION NM_001313255.1 DBLINK BioProject: PRJNA158 KEYWORDS RefSeq. SOURCE Caenorhabditis elegans ORGANISM Caenorhabditis elegans Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida; Rhabditina; Rhabditomorpha; Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis. REFERENCE 1 (bases 1 to 759) AUTHORS Sulson,J.E. and Waterston,R. CONSRTM Caenorhabditis elegans Sequencing Consortium TITLE Genome sequence of the nematode C. elegans: a platform for investigating biology JOURNAL Science 282 (5396), 2012-2018 (1998) PUBMED 9851916 REMARK Erratum:[Science 1999 Jan 1;283(5398):35] REFERENCE 2 (bases 1 to 759) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (22-NOV-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 759) AUTHORS WormBase. CONSRTM WormBase Consortium TITLE Direct Submission JOURNAL Submitted (29-OCT-2023) WormBase Group, European Bioinformatics Institute, Cambridge, CB10 1SA, UK. Email: help@wormbase.org REFERENCE 4 (bases 1 to 759) AUTHORS Sulson,J.E. and Waterston,R. TITLE Direct Submission JOURNAL Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute at Washington University, St. Louis, MO 63110, USA COMMENT REVIEWED REFSEQ: This record has been curated by WormBase. This record is derived from an annotated genomic sequence (NC_003283). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..759 /organism="Caenorhabditis elegans" /mol_type="mRNA" /strain="Bristol N2" /db_xref="taxon:6239" /chromosome="V" gene <1..>759 /gene="srlf-23" /locus_tag="CELE_T02B11.13" /db_xref="GeneID:25502988" /db_xref="WormBase:WBGene00255733" CDS 1..759 /gene="srlf-23" /locus_tag="CELE_T02B11.13" /standard_name="T02B11.13" /note="Predicted" /codon_start=1 /product="SXP/RAL-2 family protein Ani s 5-like cation-binding domain-containing protein" /protein_id="NP_001300184.1" /db_xref="EnsemblGenomes-Gn:WBGene00255733" /db_xref="EnsemblGenomes-Tr:T02B11.13" /db_xref="GeneID:25502988" /db_xref="InterPro:IPR003677" /db_xref="UniProtKB/TrEMBL:A0A0K3AY40" /db_xref="WormBase:WBGene00255733" /translation="MCSSKVALVFVASIALSTAIPILGEGGLGGLLGGNLGNPGIGGV PEVGGVGGILGDDGILGGLLGGNQNAVNGLLTILDLPSNDLQLPLLGNNSEITTLLNN FVSQISDQDLEKVQEILSSITANTPIEQVVSQLNAVNPSLGDALNQLVAGVSELLRSL FEQASEIIRSLVDVLQQLRTIVESNQTTEEKEEAINQLKENNEIQFNTILFIITQLLN NLGGIGVPELPVSTPQVPINVRLIAFSFCIFPCK" ORIGIN 1 atgtgctcgt caaaagttgc tcttgtcttc gttgcttcca ttgcactgtc tacagctatt 61 ccgattctag gagaaggtgg attaggagga cttctgggag gaaatctagg aaacccagga 121 attggtggag ttcctgaagt aggaggtgtt ggaggcatcc ttggagatga tggaatactc 181 ggaggacttc ttggtggaaa tcaaaatgca gtcaatggat tattgacaat tcttgatcta 241 ccttcaaacg atttgcaatt accactcctt ggaaataact ctgaaataac tacacttttg 301 aataatttcg ttagccagat ttccgatcaa gatcttgaaa aagttcaaga aattctatct 361 tcaataactg ctaatacacc aattgaacaa gttgtttctc aacttaatgc cgtaaatcca 421 tctctcggag atgctctcaa tcaacttgta gctggtgtct ctgaattgct tagatcacta 481 tttgaacaag cttctgaaat catcagaagt cttgtggatg ttctccaaca actgagaact 541 attgtcgaaa gtaatcaaac tactgaagaa aaagaagaag ctatcaatca attgaaggaa 601 aacaatgaaa ttcaattcaa cacaattctc ttcatcatta ctcaacttct caataacctt 661 ggaggtattg gtgttccaga gctccccgtt tcaactccac aagttccaat taatgttcga 721 ttaattgcat tctcattttg tatatttcca tgtaaataa //