ID MHC00001 standard; DNA; MAM; 226 BP. XX AC MHC00001; XX DT 27-MAY-2005 (Rel. 1.2.0, Created) DT 31-JUL-2013 (Rel. 1.9.0, Current Release) XX DE Aona-DQA1*27:01, Non-Human Primate MHC Class II sequence (partial) XX KW Non-Human Primate MHC; Class II; Aona-DQA1; Aona-DQA1*27:01; XX OS Aotus nancymaae (Nancy Ma's Night Monkey) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Primates; XX RN [1] RP 1-226 RX PUBMED; 10912504. RA Diaz D, Naegeli M, Rodriguez R, Nino-Vasquez JJ, Moreno A, Patarroyo ME, RA Pluschke G, Daubenberger CA; RT "Sequence and diversity of MHC DQA and DQB genes of the owl monkey Aotus RT nancymaae"; RL Immunogenetics 51:528-37(2000). XX DR EMBL; AF201293; AF201293.0. XX CC The nucleotide sequence provided is a CDS sequence, constructed from the CC sequences submitted to the IPD-MHC Database. The sequence below is the CC official sequence for Aona-DQA1*27:01 as approved by the NHP Nomenclature CC Committee and as a result the sequence described in any cross references CC may differ from that shown in the IPD-MHC Database. XX FH Key Location/Qualifiers FH FT source 1..226 FT /organism="Aotus nancymaae" FT /db_xref="taxon:37293" FT CDS <1..226> FT /partial FT /gene="Aona-DQA1" FT /allele="Aona-DQA1*27:01" FT /product="MHC Class II Aona-DQA1*27:01 sequence" FT /translation="DHVAAYGINLYQSYGLSGQYTHEFDGDEEFYVDLGRKETVWRLPV FT FSKFAGFDPQGALTNIAAGKHNLDILIKRS" SQ Sequence 226 BP; 57 A; 53 C; 58 G; 58 T; 0 other;