spacer

EBI Dbfetch

ID   MHC00001   standard; DNA; MAM; 226 BP.
XX
AC   MHC00001;
XX
DT   27-MAY-2005 (Rel. 1.2.0, Created)
DT   31-JUL-2013 (Rel. 1.9.0, Current Release)
XX
DE   Aona-DQA1*27:01, Non-Human Primate MHC Class II sequence (partial)
XX
KW   Non-Human Primate MHC; Class II; Aona-DQA1; Aona-DQA1*27:01;
XX
OS   Aotus nancymaae (Nancy Ma's Night Monkey)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Primates;
XX
RN   [1]
RP   1-226
RX   PUBMED; 10912504.
RA   Diaz D, Naegeli M, Rodriguez R, Nino-Vasquez JJ, Moreno A, Patarroyo ME,
RA   Pluschke G, Daubenberger CA;
RT   "Sequence and diversity of MHC DQA and DQB genes of the owl monkey Aotus
RT   nancymaae";
RL   Immunogenetics 51:528-37(2000).
XX
DR   EMBL; AF201293; AF201293.0.
XX
CC   The nucleotide sequence provided is a CDS sequence, constructed from the
CC   sequences submitted to the IPD-MHC Database. The sequence below is the
CC   official sequence for Aona-DQA1*27:01 as approved by the NHP Nomenclature
CC   Committee and as a result the sequence described in any cross references
CC   may differ from that shown in the IPD-MHC Database.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..226
FT                   /organism="Aotus nancymaae"
FT                   /db_xref="taxon:37293"
FT   CDS             <1..226>
FT                   /partial
FT                   /gene="Aona-DQA1"
FT                   /allele="Aona-DQA1*27:01"
FT                   /product="MHC Class II Aona-DQA1*27:01 sequence"
FT                   /translation="DHVAAYGINLYQSYGLSGQYTHEFDGDEEFYVDLGRKETVWRLPV
FT                   FSKFAGFDPQGALTNIAAGKHNLDILIKRS"
SQ   Sequence 226 BP; 57 A; 53 C; 58 G; 58 T; 0 other;
     ctgaccatgt tgccgcttac ggtataaact tgtaccagtc ttatggtctc tctggccagt        60
     acacccacga atttgatgga gatgaggagt tctacgtgga cctgggaaga aaggagactg       120
     tctggcgatt gcctgtgttc agcaaatttg caggttttga ccctcagggt gcactgacaa       180
     acatcgctgc gggaaaacac aacttggaca tcctgattaa acgctc                      226
//


spacer
spacer