Dbfetch

ID   IPD0000001
XX   
DT   15/07/2008 (Release)
XX   
KW   Aona-DQA1*27:01
XX   
DR   EMBL; AF201293.
XX   
CC   The nucleotide sequence provided is a CDS sequence, constructed from the
CC   sequences submitted to the IPD-MHC Database. The sequence below is the
CC   official sequence for Aona-DQA1*27:01 as approved by the MHC Nomenclature
CC   Committee and as a result the sequence described in any cross references
CC   may differ from that shown in the IPD-MHC Database.
CC   Previous nomenclature: DQA1*2701
XX   
OS   Aotus nancymaae (Nancy Ma's Night Monkey)
XX   
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; 
OC   Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Platyrrhini; 
OC   Aotidae; Aotus; 
XX   
RN   [1]
RA   Diaz D, Naegeli M, Rodriguez R, Nino-Vasquez JJ, Moreno A, Patarroyo ME,
RA   Pluschke G, Daubenberger CA.
RL   Immunogenetics
RX   PUBMED: 10912504
XX   
FH   Key            Location/Qualifier
FH   
FT   allele         1..226
FT                  /status="public"
FT   source         1..226
FT                  /db_xref="taxon:37293"
FT   CDS            1..226
FT                  /gene="DQA1"
FT                  /allele="Aona-DQA1*27:01"
FT                  /codon_start=1
FT                  /translation="DHVAAYGINLYQSYGLSGQYTHEFDGDEEFYVDLGRKETVWRLPVF
FT                  SKFAGFDPQGALTNIAAGKHNLDILIKR"
XX   
SQ   Sequence 226 BP; 57 A; 53 C; 58 G; 58 T; 0 other;
     CTGACCATGT TGCCGCTTAC GGTATAAACT TGTACCAGTC TTATGGTCTC TCTGGCCAGT        60
     ACACCCACGA ATTTGATGGA GATGAGGAGT TCTACGTGGA CCTGGGAAGA AAGGAGACTG       120
     TCTGGCGATT GCCTGTGTTC AGCAAATTTG CAGGTTTTGA CCCTCAGGGT GCACTGACAA       180
     ACATCGCTGC GGGAAAACAC AACTTGGACA TCCTGATTAA ACGCTC                      226
//