Dbfetch

ID   KIR00001   standard; DNA; HUM; 1047 BP.
XX
AC   KIR00001;
XX
DT   28-JUN-2003 (Rel. 1.0.0, Created, Version 1)
DT   17-JUL-2003 (Rel. 1.0.0, Sequence Updated, Version 1)
DT   19-JAN-2015 (Rel. 2.6.0, Current Release, Version 1)
XX
DE   KIR2DL1*001, Human Killer-cell Immunoglobulin-like Receptor
XX
KW   Human Killer-cell Immunoglobulin-like Receptor; KIR2DL1*001;
XX
OS   Homo Sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Primates;
OC   Catarrhini; Hominidae; Homo.
XX
CC   --------------------------------------------------------------------------
CC   Copyrighted by the IPD Database, Distributed under the Creative Commons
CC   Attribution-NoDerivs License, see;
CC   http://www.ebi.ac.uk/ipd/licence.html for further details.
CC   --------------------------------------------------------------------------
XX
RN   [1]
RP   1-1047
RX   PUBMED; 7716543.
RA   Colonna M, Samaridis J;
RT   "Cloning of immunoglobulin-superfamily members associated with HLA-C and
RT   HLA-B recognition by human natural killer cells";
RL   Science 268:405-8(1995).
XX
RN   [2]
RP   1-1047
RX   PUBMED; 17493149.
RA   Hou L, Steiner N, Chen M, Belle I, Ng J, Hurley CK;
RT   "KIR2DL1 allelic diversity: four new alleles characterized in a bone
RT   marrow transplant population and three families.";
RL   Tissue Antigens 69:250-4(2007).
XX
CC   --------------------------------------------------------------------------
CC   The sequence below is the official sequence for 2DL1*001, as
CC   approved by the KIR Nomenclature Committee.
CC   Any cross references may differ from the sequence shown below.
CC   --------------------------------------------------------------------------
XX
DR   EMBL; DQ666834; DQ666834.0.
DR   EMBL; L41267; L41267.0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1047
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT                   /ethnic="Unknown"
FT                   /cell_line="BF1"
FT                   /cell_line="RDP4"
FT   CDS             1..1047
FT                   /codon_start=1
FT                   /gene="KIR2DL1"
FT                   /allele="KIR2DL1*001"
FT                   /product="KIR2DL1 Killer-cell Immunoglobulin-like Receptor"
FT                   /translation="MSLLVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGPLVKSEETV
FT                   ILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSV
FT                   THSPYQVSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSRE
FT                   GEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVTG
FT                   NPSNSWPSPTEPSSKTGNPRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQES
FT                   AGNRTANSEDSDEQDPQEVTYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAES
FT                   RSKVVSCP"
FT   exon            1..34
FT                   /number="1"
FT   exon            35..70
FT                   /number="2"
FT   exon            71..370
FT                   /number="3"
FT   exon            371..664
FT                   /number="4"
FT   exon            665..715
FT                   /number="5"
FT   exon            716..817
FT                   /number="6"
FT   exon            818..870
FT                   /number="7"
FT   exon            871..1047
FT                   /number="8"
SQ   Sequence 1047 BP; 254 A; 314 C; 241 G; 238 T; 0 other;
     atgtcgctct tggtcgtcag catggcgtgt gttgggttct tcttgctgca gggggcctgg        60
     ccacatgagg gagtccacag aaaaccttcc ctcctggccc acccaggtcc cctggtgaaa       120
     tcagaagaga cagtcatcct gcaatgttgg tcagatgtca tgtttgaaca cttccttctg       180
     cacagagagg ggatgtttaa cgacactttg cgcctcattg gagaacacca tgatggggtc       240
     tccaaggcca acttctccat cagtcgcatg acgcaagacc tggcagggac ctacagatgc       300
     tacggttctg ttactcactc cccctatcag gtgtcagctc ccagtgaccc tctggacatc       360
     gtgatcatag gtctatatga gaaaccttct ctctcagccc agccgggccc cacggttctg       420
     gcaggagaga atgtgacctt gtcctgcagc tcccggagct cctatgacat gtaccatcta       480
     tccagggaag gggaggccca tgaacgtagg ctccctgcag ggcccaaggt caacggaaca       540
     ttccaggctg actttcctct gggccctgcc acccacggag ggacctacag atgcttcggc       600
     tctttccatg actctccata cgagtggtca aagtcaagtg acccactgct tgtttctgtc       660
     acaggaaacc cttcaaatag ttggccttca cccactgaac caagctccaa aaccggtaac       720
     ccccgacacc tgcacattct gattgggacc tcagtggtca tcatcctctt catcctcctc       780
     ttctttctcc ttcatcgctg gtgctccaac aaaaaaaatg ctgcggtaat ggaccaagag       840
     tctgcaggaa acagaacagc gaatagcgag gactctgatg aacaagaccc tcaggaggtg       900
     acatacacac agttgaatca ctgcgttttc acacagagaa aaatcactcg cccttctcag       960
     aggcccaaga cacccccaac agatatcatc gtgtacacgg aacttccaaa tgctgagtcc      1020
     agatccaaag ttgtctcctg cccatga                                          1047
//