Dbfetch

ID   KIR00139   standard; DNA; HUM; 10880 BP.
XX
AC   KIR00139;
XX
DT   29-APR-2005 (Rel. 1.2.0, Created, Version 1)
DT   15-APR-2011 (Rel. 2.4.0, Sequence Updated, Version 3)
DT   19-JAN-2015 (Rel. 2.6.0, Current Release, Version 3)
XX
DE   KIR3DL3*005, Human Killer-cell Immunoglobulin-like Receptor
XX
KW   Human Killer-cell Immunoglobulin-like Receptor; KIR3DL3*005;
XX
OS   Homo Sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Primates;
OC   Catarrhini; Hominidae; Homo.
XX
CC   --------------------------------------------------------------------------
CC   Copyrighted by the IPD Database, Distributed under the Creative Commons
CC   Attribution-NoDerivs License, see;
CC   http://www.ebi.ac.uk/ipd/licence.html for further details.
CC   --------------------------------------------------------------------------
XX
RN   [1]
RP   1-10880
RX   PUBMED; 16634863.
RA   Steiner NK, Hurley CK;
RT   "KIR3DL3 allelic diversity: six new alleles exhibit both conservative and
RT   nonconservative substitutions";
RL   Tissue Antigens 67:277-83(2006).
XX
RN   [2]
RP   1-10880
RX   PUBMED; 17900289.
RA   Hou L, Chen M, Steiner NK, Belle I, Turino C, Ng J, Hurley CK;
RT   "Seventeen novel alleles add to the already extensive KIR3DL3 diversity";
RL   Tissue Antigens 70:449-54(2007).
XX
CC   --------------------------------------------------------------------------
CC   The sequence below is the official sequence for 3DL3*005, as
CC   approved by the KIR Nomenclature Committee.
CC   Any cross references may differ from the sequence shown below.
CC   --------------------------------------------------------------------------
XX
DR   EMBL; AY987939; AY987939.0.
DR   EMBL; EF492037; EF492037.0.
DR   EMBL; GU182342; GU182342.0.
DR   EMBL; HM999926; HM999926.0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..10880
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT                   /ethnic="Black"
FT                   /cell_line="FH08"
FT                   /cell_line="GM17143"
FT                   /cell_line="GU1183"
FT                   /cell_line="RDP9"
FT   CDS             join(1..34,35..70,301..585,1859..2158,3741..4034,
FT                   9500..9604,10067..10119,10218..10343)
FT                   /codon_start=1
FT                   /gene="KIR3DL3"
FT                   /allele="KIR3DL3*005"
FT                   /product="KIR3DL3 Killer-cell Immunoglobulin-like Receptor"
FT                   /translation="MSLMVVSMACVGFFLLEGPWPHVGGQDKPFLSAWPGTVVSEGQHV
FT                   TLQCRSRLGFNEFSLSKEDGMPVPELYNRIFRNSFLMGPVTPAHAGTYRCCSSHPHSPT
FT                   GWSAPSNPVVIMVTGVHRKPSLLAHPGPLVKSGETVILQCWSDVRFERFLLHREGITED
FT                   PLRLVGQLHDAGSQVNYSMGPMTPALAGTYRCFGSVTHLPYELSAPSDPLDIVVVGLYG
FT                   KPSLSAQPDPTVQAGENVTLSCSSRSLFDIYHLSREAEAGELRLTAVLRVNGTFQANFP
FT                   LGPVTHGGNYRCFGSFRALPHAWSDPSDPLPVSVTGNSRHLHVLIGTSVVIIPFAILLF
FT                   FLLHRWCANKKNAVVMDQEPAGNRTVNREDSDEQDPQEVTYAQLNHCVFTQRKITRPSQ
FT                   RPKTPPTDTSV"
FT   exon            1..34
FT                   /number="1"
FT   exon            35..70
FT                   /number="2"
FT   intron          71..300
FT                   /number="2"
FT   exon            301..585
FT                   /number="3"
FT   intron          586..1858
FT                   /number="3"
FT   exon            1859..2158
FT                   /number="4"
FT   intron          2159..3740
FT                   /number="4"
FT   exon            3741..4034
FT                   /number="5"
FT   intron          4035..9499
FT                   /number="5"
FT   exon            9500..9604
FT                   /number="6"
FT   intron          9605..10066
FT                   /number="6"
FT   exon            10067..10119
FT                   /number="7"
FT   intron          10120..10217
FT                   /number="7"
FT   exon            10218..10343
FT                   /number="8"
FT   UTR             10344..10880
SQ   Sequence 10880 BP; 2979 A; 2567 C; 2683 G; 2651 T; 0 other;
     atgtcgctca tggtcgtcag catggcgtgt gttgggttct tcttgctgga ggggccctgg        60
     ccacatgtgg actgttaaaa tctagtaaga gtcgcttctt cagcacctgc tcaaagttct       120
     cagctgacac ttgctgtagg gagacgccat gtctatgcgg gatgggtcct tcctgtagcc       180
     ctgggcaccc aggtgtggta ggagccttag aaacatggaa atgggagaat cttctgagca       240
     cagggaggga ggggcggctc cacatcctcc tctctaaggt ggtgcctcct tctcccccag       300
     gtggtcagga caagcccttc ctctctgcct ggcccggcac tgtggtgtct gaaggacaac       360
     atgtgactct tcagtgtcgc tctcgtcttg ggtttaatga attcagtctg tccaaagaag       420
     acgggatgcc tgtccctgag ctctacaaca gaatattccg gaacagcttt ctcatgggcc       480
     ctgtgacccc agcacatgca gggacctaca gatgttgcag ttcacaccca cactccccca       540
     ctgggtggtc ggcacccagc aaccctgtgg tgatcatggt cacaggtcag aggctttctg       600
     tctgggcttc tcactgtccc acctcctgaa tcccagagct tctggtgggg gcgtccatca       660
     gggtccaatc atccaggccc cgactgtatt tggggtaaag ggggattcag tacagagaaa       720
     tagttgctgt ggtgggaaga ataattgtcc ccagtgatgg ctacatggta atccatgaac       780
     cctgtgacta tttatgttat agggcagggg actgaagagg aagatggagc tcaggttgtt       840
     gatgagttga ccttgcgatg gggagacagc ctggactgtc ctgctgtgct cagagtaatc       900
     acaagggtcc tcatgagagg aggaggaaga ggaaagtggg gttagagcaa cgtcgtggga       960
     gggagactcc atcagccaca gcaggctttg aagatggggg aaggccatga gccacaaagg      1020
     caggtggcct ctaagggctg gagaagtcaa gggaactgat tcttccctga gtctccagag      1080
     gaaacacagc cctgcagatg ccttgatttt agcccagaga gaactgggtc cgatttctgt      1140
     tctccagaag tggaaggggt cattgtattc tctcctgccc catgtttgtg acaattttct      1200
     ccagcagcaa caggaaacca acacaggaac ccaggtgaag cacaggttaa gaaaccaaac      1260
     aaggagaagt ttggctacac tgattttagc atgggtggga tactgatgct accaccaggc      1320
     tcgatccaca tagggagggg ttgatgctcc tggaaccagc accaggggcc accctatgga      1380
     agctggggcc atggagaaga cacagacatg aaaggagagg ctcccaatcc ccatcaggaa      1440
     cagggacact gatgcctgcc ttactgatga gttcgtacct cctgccggcc tttccaatct      1500
     gtccaaaaga gattgattca ggctgctaag agcctggaca tgcagcctgt catggttcct      1560
     cttccacccc cacataaaca ccaggaaaga gattagtggg aaacagatac aacagcctaa      1620
     gaggtgacac tgagcacagt gggaagggaa tcagggctac tagagacaga gagacaggga      1680
     agagggaggg agacagatgg agggacctgc aacaggggtt atgggcacaa aggaacacgg      1740
     agacacagac aggaaggaga gagatagaca ccatggaggg gaagcctcac ttatttcagg      1800
     tcccatgaat gggatgagaa agggagacgc cttctgaact cacaacctct cttcttagga      1860
     gtccacagaa aaccttccct cctggcccac ccaggtcccc tggtgaaatc aggagagacg      1920
     gtcatcctgc aatgttggtc agatgtcagg tttgagcgct tccttctgca cagagagggg      1980
     atcactgagg accccttgcg cctcgttgga cagctccacg atgcgggttc ccaggtcaac      2040
     tattccatgg gtcccatgac acctgccctt gcagggacct acagatgctt tggttctgtc      2100
     actcacttac cctatgagtt gtcggctccc agtgaccctc tggacatcgt ggtcgtaggt      2160
     gagagaatac agacctgcct ctcacccttg ctgggagatg gagtgaatga tctaggactg      2220
     gaagccccag gtggtcatga ggaagatgag tgtggggttc ctatggagag aaagtgactt      2280
     ggtgaggtct gtaccaacaa aggcagagaa acaggagaca caagtacaga cctcatgtca      2340
     taacatagaa gccagacaca ggggccatac aaggtgttag aaaaagagat aaagaggtaa      2400
     agaagacaca gagagacaga catatcccag agagaggtgt ccttctatgc tgactttgtt      2460
     cagagaccag gcacaggtta gaaggttcca ttctgtttta cctctacaaa gtgttctctc      2520
     ccaggagaac ccaaagagac acatctatct ggcctgagtt gggccatgtg gccccaggct      2580
     ggtggcacct acagatgttg tgtttattct taaacctctg ccttccgtgc agtggagctg      2640
     tcatcgtccc aggacaccat ggccccaggt gagggagcag aacaccaacc cctgtatgct      2700
     gtgagttcct ggagtcccca tactggattc tgaggctcat attcaaatag caccacatgt      2760
     tataggatta ctgagaacaa aagcccacag agagacacgg agtgaaatca gggaaatcaa      2820
     aaagcaaaga catgaacaca cacacagaat gagccagaag aagggaattg agagactcac      2880
     agacacataa agagatagaa aaagagggca gagaagtgga gcgtatgatg gaaggaagca      2940
     gagaaaagcc ctaaaatcag agccctgagg gaggggcaca aagacaggga aagataaaga      3000
     tgtgaggatg gattgcagag actccaaaag ggaactagag agactgagag gcagagaaag      3060
     acaaggagat ggagagagac agatgataga tggacagata gatatagata gatgaaagat      3120
     aaaaggtaga tgatagataa tagagagaca ggtgatagac aaatagatga tgaatgactg      3180
     atagatgata tagatagaca agtagaaaga cagacagatg atatataaat agatatagag      3240
     agatagaaag acagataaac acatgatgat agatggatag atgcatacat acatacattg      3300
     attgatagat gatagataac agagagatag gtcatagata cacagatgat gatagatgat      3360
     agatacatac atagataaat gatagatcga tcaatagata gtagatagaa atatgcagaa      3420
     agttatgagc aagacagaaa gtgagagact cagaattaaa gaaagaggaa gatcaagtca      3480
     accagtccaa ggagggtcag agagaataaa atggtacaaa aaaagaaaac atagctaggg      3540
     atggagaagt gaggtcagag acctagagag acagagaagg tggaaggagg aaatagacat      3600
     gaagagagat gggggtggag ggtgagagag agaaagagag cattaagtca tagagcaggg      3660
     gagtgagttc tcagctcagg tgtgaggaga gctgtgacaa ggaagaacct ccctgaggaa      3720
     accacctctt ctccttccag gtctatatgg gaaaccttct ctctcagccc agccggaccc      3780
     cacggttcag gcaggagaga atgtgacctt gtcctgcagc tctcggagct tgtttgacat      3840
     ttaccatcta tccagggagg cagaggccgg tgaacttagg ctcactgcag tgctgagggt      3900
     caatggaaca ttccaggcca acttccctct gggccctgtg acccacggag ggaactacag      3960
     atgcttcggc tctttccgtg ccctgcccca cgcgtggtca gacccgagtg acccactgcc      4020
     cgtttctgtc acaggtgaga aaacaccatg cctgtcccat gtcttgtgat cctagagcca      4080
     tagctgagga gcttcctgct gatgatggag agaagcatgg acagatgccg agacagaaca      4140
     cacagcatgg gtgtaagggc ggggtcaggg cgcaggatgg cagacagggc acctccaaac      4200
     cctcctgtat ggcctgcaag gaggcccttg atcagggttc caggcaccca ggcagatgga      4260
     gaaagaggtc agaacagacc cagaggaggg agactgggct ctgcctgggg agatcagagg      4320
     ttctctcagc ccctcaacct tacccacttc ccagaagccc atcctggcct gtcacccaca      4380
     gagagatgtc atcaccagca acgcctacac ccttttcttt ttgtttgaag aaatatttat      4440
     tgaggtgaaa tatacctatg taatttacca cctttaccat ttttaagtgt gaagtctact      4500
     gttcataaat acatttatag gctgggcacg gtggctcacg gttgtaatcc caacactttg      4560
     agaggccaag gcaggtggat catttgagat caggggctca agaccaccct ggccaacatg      4620
     gggaaaatcc atctgtacta aaaatacaaa ataataatta taatgataat aattagccga      4680
     gcatggtggc acatgcctgt agtcccagct acttggtagg gttgggcagg agttgcactt      4740
     aattgcagga ggcggaggtt gcagtgagct gagatcatgc cactgcactg cagcctgggc      4800
     aacagagaga gacactctct caaaattaat taattaatta attagtattc tttttttttt      4860
     accctccacc cttcccttcc tggcctctgg tagccaccat tctactctct acctttgtga      4920
     gatccacctt ttagctcctg catatgagtg agaaatggaa atacttgtaa tgacctccag      4980
     ttccattcat gtggctgtaa atgacaggat gttactcttt ctatggatga gttgtcccta      5040
     ttgtgtgtgt gtaccacatt ctctccatcc attcacccac tgatgggcag gtaggttgat      5100
     ccacatcttg gctactgtga acactgctgg aacagtcatg ggagtgcaga tgtcacttcg      5160
     atacgctgat gtcctttcct ttgggtttac acccagtcat ggaattgcta gatcctctgg      5220
     aagtgtcttt ttacattttg ttttatggtt tttgtttttg tttttgtttt ttttagacag      5280
     tttcactctt gttgcccagg ctggagtgca gtggcgccat ctgggctcac tgcaacctcc      5340
     acctccagga ttcaagagat tccccagcct cagcctccca agtagctggg ttactggctc      5400
     ccaccaccac actcggctaa tttttatatt tttagtagag acagagtttc gctatattgg      5460
     ccaggctgct cttcaactcc tgacctcaag tgacctaccc acctcggcct cccaatgtgc      5520
     tgggattaca ggcatgaacc actgtgcccg acctcatttt attttttgag gaacttccat      5580
     actcttctcc tctgtaatgg ctgtactaat ttacattcgt atcagcagtg taccagatgc      5640
     aaccctggtt gactcagcag agcaagagac gtgcagtaag agagaattta gcttatttat      5700
     gcacacgaca cttccactca ctcactcgtt cagccaatgc cccatgctct ggctgtgcag      5760
     tgtggaatct tttcctattg ttgccataac aaatttccac aagcttcgtg gatgaaaacg      5820
     tgtttttctt aattatctca cagtgctgta actcagaagt atgaactgca tttcactggg      5880
     ctgatatcaa agggagagta aggctggatt tctttttaag gttccaagca agaatctgct      5940
     ccttaacgtt tcccagctcc tagaggctcc cacgttcctg ggctcctggt ccccttcctc      6000
     cttcctcctt cctcaaagcc cacaaaggct ggtcacgtct cacatggcat cattcagaat      6060
     cttcttcttt acccacacct ttttctctga atcctgctct gccttcttcc tcatctttta      6120
     aggactttgg gattctattg gggtcaccaa gataatccat ctcaatctcc ctaaaatcat      6180
     ccagcgtacc ctctttttaa gttcagctga ttagcaaccg taatgccatc tgcaatcttc      6240
     attcctcctt tcctgtaaaa taacatattc acaagctatg gaggctaaga cagggacatt      6300
     ttgggggtgg ggcagcattc tcctgccttc cacaaatggt aaacaggatg catttggcct      6360
     ctgctcttgg gacgctgata ttgcagatgg gtaaatgcga gggcagagaa tgaatgcaca      6420
     agggtaccaa taaatgaatg atccattggg aagcatctgt gcaccaaatc tggggttttt      6480
     tgtgtgtgtg tgtttttttt gttttctttt tttttttgag tagagtctct ctctgttcca      6540
     caggctggag tgcagtagca caatctcagc tcattgcaac ctctgcctcc tgggttcatg      6600
     caattctcct gcctcagcct accgagtagc tgggattaca gctgtgcgcc accacactcg      6660
     gctaattttt ttggtatatt ttttagtaga aatgaggttt caccatgttg tgcaggctgt      6720
     ctcaaactcc caatctcaag tgatcccacc gccttagcgt ccctaagtgc aaagattaca      6780
     ggcgagagct actgcgccca gccaggattt aaaataagta atagataatg ctgagtatac      6840
     aatttcaggt gacagagaag gtctcactga tcagataata tttgtgacct taatggaaaa      6900
     aatggattca acccttggaa gattggcgga aggattttcc acactgagct ctcagccgtg      6960
     aaggcacaaa ggtggaaaca ttcttagttc aaggaagagg ctctgcctca aatgctggga      7020
     atgagatggg gagaatgaca agacgactgt ggagagacgg agagtacact gggtacacag      7080
     gaaactaagg aggaacaagg agcgtgtgtt tgacactcac agcccttgga ttcaactcag      7140
     agctaactag gaatccctac ctgattaaca gtgaccgaca tgaaaataag ggaggcccag      7200
     gtgcgtaact ggaatctagg agaccgtgga aaaggcaatt cccgccccac tggtgaaacg      7260
     tagggttgat ttacacacta aatgaatgaa agatggatat aagctatgct tgtgaggtag      7320
     aatcatttgc agggagggct tgctgggttt gatttttcct agtagtttaa tccttgtttc      7380
     attaatttct ttctgagatg tgtttttttt ctacatctaa atcaatacct ggcagaggag      7440
     cgatagacac atgaggggtg gtgcaaatga agggacctag tataatataa tatacaagac      7500
     tgtggatggg ggctcacacc tgtaacccaa cactttggga ggccaaggcg ggtagatcac      7560
     ttaagggtag gagtttgaga ccagcctggc caacatggtg aaaccccgtc tgtactaaaa      7620
     atacaaaaat tagcctggtg cattggcacc tgcctgtaat cccagcgact ggggaggctg      7680
     aagcagaaga atggcttcaa ccctggaggc agaggttgaa ctgagatcgc atcactgcac      7740
     tccagcctga cacaggggga ctctgtctca aaaaataaaa ataaaacata cataattatg      7800
     acacacagaa attacaaagg caactggata ccaaccatca tttttctatt tctctgtgtt      7860
     taattctttg accctttatc ttatccatta aacaatcagg ttaaacctct tccttatttg      7920
     gctttctgtg agcttgggat catatggaaa atgtgaaagc ctcctgaacc caccagcaca      7980
     ggtcctggaa tagagaacgt gctctgttca tggcataaaa cttgcccctt cacccaaatc      8040
     ccccaattca tctctacttc caatcaccta tggagataca gatagatcat ggggaggtaa      8100
     acactgatac tctttggagt gagctcagat cttggactca gagaccagtg ccagcactag      8160
     cccctggtca catttcgtac taactcacag aaggacaggc tgtattgaaa caataaacga      8220
     cggagagggc ggtccttccc cgtgcttctc gggtggaata gcagcctaat atatgtctca      8280
     gcagatcaca aaaagtagca tgttgttcct gggctacatc attatttcat ggctgtttga      8340
     tttaagtcag ttctacttca ctttttttat cttgatttca ttttttcttt cttttcttgg      8400
     agaatgtaat ttttttgagt caagagggtt gtggtggtag aaactgtaaa gcacattcgc      8460
     tgtgtatcaa tcccaatcca gtcttcccag agaagattct aaacacctcc tggaatgcac      8520
     ctgggcctat accaattcct atcactcacc gtcactccag ggagacagaa cacacagaga      8580
     acacattaca caggcaggtt cattactaac agataagcag cgagtgacaa cagaaaccta      8640
     catttcaatg tgagccagtc cctcaaggct cagaaaagct gctcgagaca tgtggagtca      8700
     ccccatatgc agtgtatctg ggggaaatca aaaagcagcc cagcctgggt tttgtaccct      8760
     ggagccacag gaagcactca gctaaagcac tgcatgactt cctcctccag gaagaacagg      8820
     aagacagccc aggctgttct gggatgttcc tcctgatctc aggacgttgc tgtcttagtc      8880
     catttttgtt gctctaaagg aacacttgag cctgggtaac ttctaaagaa aagaaatgtg      8940
     tttgcctcac agttctgcag gctgtactgg aagcatggca ccagcatcta tttcttgtga      9000
     cggcctcagg ctgctcccac tctggcagaa gggaaggagg gtctgtctgt gcagagacca      9060
     cagagatcac acggcaagag agggaccaag ggggaggggg agcgatggag cttccaagct      9120
     cttttaacaa ccagttctcc aggaactaat agagggggaa cttgctaacc ccgtctcctt      9180
     ggaacagcat tgatctgttc atgatggatc cacctccatg acccaaacaa ctcccaagag      9240
     gcccaacctc ccaccctggg ggttacattt caatgtgagg tttgaagggg tcaaacatct      9300
     aaactaaagc agttgtatcc tcagcacgtt ctatggttac tacaactgag aaagcaggag      9360
     gaagctaggt ctcccgccat ctgggtgctt gtcctaaaga gacgttgtat gtggttacct      9420
     gtcaatcaag aaatgtgaga caattcatat agaggaactg ctatgattag cttcttattg      9480
     gtgtcttgtc ttcctccagg taactccaga cacctgcacg ttctgattgg gacctcagtg      9540
     gtcatcatcc cctttgctat cctcctcttc tttctccttc atcgctggtg tgccaacaaa      9600
     aagagtaact ctcacgaagc agaagccaga gagctcaggg ccatgtgggg aagcaggatg      9660
     ggagcactca ggtgtgtgtt cctcacaggc aggatggtcc ctggcccaag gcaggagcca      9720
     cagaggcagg actttctaga gagagcacca gactccctgc ctctgccttc agctcacaga      9780
     ccattgcctg attctgaacc gtatcctcac atcccctgca gccactcaca tccaggagaa      9840
     ggttccatga caggcagaaa gtgggacaca gaatcaatag gatgggaact cagagctata      9900
     catgggatgg atccttgagc tcagagagat agaatgtctg agtctgctgt tggcaactga      9960
     gggacctcag gcacctatgg cctccccctg tatgttggta tctgcttatg aaatgaggac     10020
     ccagaagtgc cctccgagct gttttgacga cttccgtctt ctacagatgc tgttgtaatg     10080
     gaccaagagc ctgcagggaa cagaacagtg aacagggagg taggtgctcc tccgcccagc     10140
     ctcgtggcta gtcttattcc caaagagtcc tggaaaatgt gagcaccctc cctcactcag     10200
     catttccctc cctccaggac tctgatgaac aagaccctca ggaggtgaca tacgcacagt     10260
     tgaatcactg cgttttcaca cagagaaaaa tcactcgccc ttctcagagg cccaagacac     10320
     ccccaacaga taccagcgtg taacacggaa cttccaaatg ctgagcgcag atccaaagtt     10380
     gtcttctgtc cactagcacc acagtcaggc cttgatggga tcttctaggg agacaatagc     10440
     cctgtctcaa aaccgggttg ccagctccca tgtaccagca gctggactct gaaggcgtga     10500
     gtctgcatct tagggcatcg ctcttcctca caccacgaat ctgaacatgc ctctctcttg     10560
     cttacaaatg tctaaggtcc ccactgcctg ctggagagaa aacacacttg cttagcccac     10620
     aattctccat ttcacttgac ccctgcccac ctctccaacc taactggctt acttcctagt     10680
     ctacttgagg ctgcgatcac actgaggaac tcacaattcc aaacatataa gaggctccct     10740
     cttaacacgg cacttagata cgtgctattc cacctttcct cagagtatct ttcagccttc     10800
     tgtcagcagt aaaacttata aatttttttt ataatttcaa tgtagttttc tattcttcaa     10860
     gtaaacatgt ctgccctcat                                                 10880
//