Dbfetch

ID   KIR00139; SV 3; standard; DNA; HUM; 10608 BP.
XX
AC   KIR00139;
XX
SV   KIR00139.3
XX
DT   29-APR-2005 (Rel. 1.2.0, Created, Version 1)
DT   15-APR-2011 (Rel. 2.4.0, Sequence Updated, Version 3)
DT   27-OCT-2017 (Rel. 2.7.0.1, Current Release, Version 3)
XX
DE   KIR3DL3*005, Human Killer-cell Immunoglobulin-like Receptor
XX
KW   Human Killer-cell Immunoglobulin-like Receptor; KIR3DL3*005;
XX
OS   Homo Sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Primates;
OC   Catarrhini; Hominidae; Homo.
XX
CC   --------------------------------------------------------------------------
CC   IPD-KIR Release Version 2.7.0.1
CC   --------------------------------------------------------------------------
CC   Copyrighted by the IPD Database, Distributed under the Creative Commons
CC   Attribution-NoDerivs License, see;
CC   http://www.ebi.ac.uk/ipd/licence.html for further details.
CC   --------------------------------------------------------------------------
XX
RN   [1]
RP   1-10608
RX   PUBMED; 16634863.
RA   Steiner NK, Hurley CK;
RT   "KIR3DL3 allelic diversity: six new alleles exhibit both conservative and
RT   nonconservative substitutions";
RL   Tissue Antigens 67:277-83(2006).
XX
RN   [2]
RP   1-10608
RX   PUBMED; 17900289.
RA   Hou L, Chen M, Steiner NK, Belle I, Turino C, Ng J, Hurley CK;
RT   "Seventeen novel alleles add to the already extensive KIR3DL3 diversity";
RL   Tissue Antigens 70:449-54(2007).
XX
CC   --------------------------------------------------------------------------
CC   The sequence below is the official allele sequence as approved by the
CC   KIR Nomenclature Committee.
CC   Any cross references may differ from the sequence shown below.
CC   --------------------------------------------------------------------------
XX
DR   EMBL; AY987939; AY987939.0.
DR   EMBL; EF492037; EF492037.0.
DR   EMBL; GU182342; GU182342.0.
DR   EMBL; HM999926; HM999926.0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..10608
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT                   /ethnic="Black"
FT                   /cell_line="FH08"
FT                   /cell_line="GM17143"
FT                   /cell_line="GU1183"
FT                   /cell_line="RDP9"
FT   CDS             join(1..34,35..70,841..1125,2399..2698,4281..4574,
FT                   10041..10145,10251..10303,10357..10482)
FT                   /codon_start=1
FT                   /gene="KIR3DL3"
FT                   /allele="KIR3DL3*005"
FT                   /product="KIR3DL3 Killer-cell Immunoglobulin-like Receptor"
FT                   /translation="MSLMVVSMACVGFFLLEGPWPHVGGQDKPFLSAWPGTVVSEGQHV
FT                   TLQCRSRLGFNEFSLSKEDGMPVPELYNRIFRNSFLMGPVTPAHAGTYRCCSSHPHSPT
FT                   GWSAPSNPVVIMVTGVHRKPSLLAHPGPLVKSGETVILQCWSDVRFERFLLHREGITED
FT                   PLRLVGQLHDAGSQVNYSMGPMTPALAGTYRCFGSVTHLPYELSAPSDPLDIVVVGLYG
FT                   KPSLSAQPDPTVQAGENVTLSCSSRSLFDIYHLSREAEAGELRLTAVLRVNGTFQANFP
FT                   LGPVTHGGNYRCFGSFRALPHAWSDPSDPLPVSVTGNSRHLHVLIGTSVVIIPFAILLF
FT                   FLLHRWCANKKNAVVMDQEPAGNRTVNREDSDEQDPQEVTYAQLNHCVFTQRKITRPSQ
FT                   RPKTPPTDTSV"
FT   exon            1..34
FT                   /number="1"
FT   exon            35..70
FT                   /number="2"
FT   intron          71..840
FT                   /number="2"
FT   exon            841..1125
FT                   /number="3"
FT   intron          1126..2398
FT                   /number="3"
FT   exon            2399..2698
FT                   /number="4"
FT   intron          2699..4280
FT                   /number="4"
FT   exon            4281..4574
FT                   /number="5"
FT   intron          4575..10040
FT                   /number="5"
FT   exon            10041..10145
FT                   /number="6"
FT   intron          10146..10250
FT                   /number="6"
FT   exon            10251..10303
FT                   /number="7"
FT   intron          10304..10356
FT                   /number="7"
FT   exon            10357..10482
FT                   /number="8"
FT   UTR             10483..10608
SQ   Sequence 10608 BP; 2917 A; 2458 C; 2663 G; 2570 T; 0 other;
     atgtcgctca tggtcgtcag catggcgtgt gttgggttct tcttgctgga ggggccctgg        60
     ccacatgtgg gtgagtcctt cccccaaacc ttaggttgtc atctccccac ataagatgat       120
     gctcctgaaa cgggaggcag gcgacacagg gggttgactg atgggctgac catgggaagc       180
     catgtgggaa tctctcatga actaggaaaa ggaagccagg ggaagcttcg ccacagttct       240
     gtcctagccc tccccggcct ttctttccct tggctgagtc tgtggggacc cagggggaga       300
     ctgaagtgct caaaggagtg gtgtgcaggg aggaagtggt gtcaccggca gaggaaggga       360
     gagaagcagt gcaaggaaca acaggcctct gaggacaaga gcataactca caccctccag       420
     cgtttccatg acggtagggg ctgcaatgtg gctgctgtca ttctacctaa gaggtggggg       480
     aaccacagtc atgaccctga cattccagat cttctaatag gggctcagtt gtttattatg       540
     gttcatgcat tagctgatca tgccctccat cctgtgtcta ccttgtgttc ttttatgtaa       600
     gtaattttgc agtgttaaaa tctagtaaga gtcgcttctt cagcacctgc tcaaagttct       660
     cagctgacac ttgctgtagg gagacgccat gtctatgcgg gatgggtcct tcctgtagcc       720
     ctgggcaccc aggtgtggta ggagccttag aaacatggaa atgggagaat cttctgagca       780
     cagggaggga ggggcggctc cacatcctcc tctctaaggt ggtgcctcct tctcccccag       840
     gtggtcagga caagcccttc ctctctgcct ggcccggcac tgtggtgtct gaaggacaac       900
     atgtgactct tcagtgtcgc tctcgtcttg ggtttaatga attcagtctg tccaaagaag       960
     acgggatgcc tgtccctgag ctctacaaca gaatattccg gaacagcttt ctcatgggcc      1020
     ctgtgacccc agcacatgca gggacctaca gatgttgcag ttcacaccca cactccccca      1080
     ctgggtggtc ggcacccagc aaccctgtgg tgatcatggt cacaggtcag aggctttctg      1140
     tctgggcttc tcactgtccc acctcctgaa tcccagagct tctggtgggg gcgtccatca      1200
     gggtccaatc atccaggccc cgactgtatt tggggtaaag ggggattcag tacagagaaa      1260
     tagttgctgt ggtgggaaga ataattgtcc ccagtgatgg ctacatggta atccatgaac      1320
     cctgtgacta tttatgttat agggcagggg actgaagagg aagatggagc tcaggttgtt      1380
     gatgagttga ccttgcgatg gggagacagc ctggactgtc ctgctgtgct cagagtaatc      1440
     acaagggtcc tcatgagagg aggaggaaga ggaaagtggg gttagagcaa cgtcgtggga      1500
     gggagactcc atcagccaca gcaggctttg aagatggggg aaggccatga gccacaaagg      1560
     caggtggcct ctaagggctg gagaagtcaa gggaactgat tcttccctga gtctccagag      1620
     gaaacacagc cctgcagatg ccttgatttt agcccagaga gaactgggtc cgatttctgt      1680
     tctccagaag tggaaggggt cattgtattc tctcctgccc catgtttgtg acaattttct      1740
     ccagcagcaa caggaaacca acacaggaac ccaggtgaag cacaggttaa gaaaccaaac      1800
     aaggagaagt ttggctacac tgattttagc atgggtggga tactgatgct accaccaggc      1860
     tcgatccaca tagggagggg ttgatgctcc tggaaccagc accaggggcc accctatgga      1920
     agctggggcc atggagaaga cacagacatg aaaggagagg ctcccaatcc ccatcaggaa      1980
     cagggacact gatgcctgcc ttactgatga gttcgtacct cctgccggcc tttccaatct      2040
     gtccaaaaga gattgattca ggctgctaag agcctggaca tgcagcctgt catggttcct      2100
     cttccacccc cacataaaca ccaggaaaga gattagtggg aaacagatac aacagcctaa      2160
     gaggtgacac tgagcacagt gggaagggaa tcagggctac tagagacaga gagacaggga      2220
     agagggaggg agacagatgg agggacctgc aacaggggtt atgggcacaa aggaacacgg      2280
     agacacagac aggaaggaga gagatagaca ccatggaggg gaagcctcac ttatttcagg      2340
     tcccatgaat gggatgagaa agggagacgc cttctgaact cacaacctct cttcttagga      2400
     gtccacagaa aaccttccct cctggcccac ccaggtcccc tggtgaaatc aggagagacg      2460
     gtcatcctgc aatgttggtc agatgtcagg tttgagcgct tccttctgca cagagagggg      2520
     atcactgagg accccttgcg cctcgttgga cagctccacg atgcgggttc ccaggtcaac      2580
     tattccatgg gtcccatgac acctgccctt gcagggacct acagatgctt tggttctgtc      2640
     actcacttac cctatgagtt gtcggctccc agtgaccctc tggacatcgt ggtcgtaggt      2700
     gagagaatac agacctgcct ctcacccttg ctgggagatg gagtgaatga tctaggactg      2760
     gaagccccag gtggtcatga ggaagatgag tgtggggttc ctatggagag aaagtgactt      2820
     ggtgaggtct gtaccaacaa aggcagagaa acaggagaca caagtacaga cctcatgtca      2880
     taacatagaa gccagacaca ggggccatac aaggtgttag aaaaagagat aaagaggtaa      2940
     agaagacaca gagagacaga catatcccag agagaggtgt ccttctatgc tgactttgtt      3000
     cagagaccag gcacaggtta gaaggttcca ttctgtttta cctctacaaa gtgttctctc      3060
     ccaggagaac ccaaagagac acatctatct ggcctgagtt gggccatgtg gccccaggct      3120
     ggtggcacct acagatgttg tgtttattct taaacctctg ccttccgtgc agtggagctg      3180
     tcatcgtccc aggacaccat ggccccaggt gagggagcag aacaccaacc cctgtatgct      3240
     gtgagttcct ggagtcccca tactggattc tgaggctcat attcaaatag caccacatgt      3300
     tataggatta ctgagaacaa aagcccacag agagacacgg agtgaaatca gggaaatcaa      3360
     aaagcaaaga catgaacaca cacacagaat gagccagaag aagggaattg agagactcac      3420
     agacacataa agagatagaa aaagagggca gagaagtgga gcgtatgatg gaaggaagca      3480
     gagaaaagcc ctaaaatcag agccctgagg gaggggcaca aagacaggga aagataaaga      3540
     tgtgaggatg gattgcagag actccaaaag ggaactagag agactgagag gcagagaaag      3600
     acaaggagat ggagagagac agatgataga tggacagata gatatagata gatgaaagat      3660
     aaaaggtaga tgatagataa tagagagaca ggtgatagac aaatagatga tgaatgactg      3720
     atagatgata tagatagaca agtagaaaga cagacagatg atatataaat agatatagag      3780
     agatagaaag acagataaac acatgatgat agatggatag atgcatacat acatacattg      3840
     attgatagat gatagataac agagagatag gtcatagata cacagatgat gatagatgat      3900
     agatacatac atagataaat gatagatcga tcaatagata gtagatagaa atatgcagaa      3960
     agttatgagc aagacagaaa gtgagagact cagaattaaa gaaagaggaa gatcaagtca      4020
     accagtccaa ggagggtcag agagaataaa atggtacaaa aaaagaaaac atagctaggg      4080
     atggagaagt gaggtcagag acctagagag acagagaagg tggaaggagg aaatagacat      4140
     gaagagagat gggggtggag ggtgagagag agaaagagag cattaagtca tagagcaggg      4200
     gagtgagttc tcagctcagg tgtgaggaga gctgtgacaa ggaagaacct ccctgaggaa      4260
     accacctctt ctccttccag gtctatatgg gaaaccttct ctctcagccc agccggaccc      4320
     cacggttcag gcaggagaga atgtgacctt gtcctgcagc tctcggagct tgtttgacat      4380
     ttaccatcta tccagggagg cagaggccgg tgaacttagg ctcactgcag tgctgagggt      4440
     caatggaaca ttccaggcca acttccctct gggccctgtg acccacggag ggaactacag      4500
     atgcttcggc tctttccgtg ccctgcccca cgcgtggtca gacccgagtg acccactgcc      4560
     cgtttctgtc acaggtgaga aaacaccatg cctgtcccat gtcttgtgat cctagagcca      4620
     tagctgagga gcttcctgct gatgatggag agaagcatgg acagatgccg agacagaaca      4680
     cacagcatgg gtgtaagggc ggggtcaggg cgcaggatgg cagacagggc acctccaaac      4740
     cctcctgtat ggcctgcaag gaggcccttg atcagggttc caggcaccca ggcagatgga      4800
     gaaagaggtc agaacagacc cagaggaggg agactgggct ctgcctgggg agatcagagg      4860
     ttctctcagc ccctcaacct tacccacttc ccagaagccc atcctggcct gtcacccaca      4920
     gagagatgtc atcaccagca acgcctacac ccttttcttt ttgtttgaag aaatatttat      4980
     tgaggtgaaa tatacctatg taatttacca cctttaccat ttttaagtgt gaagtctact      5040
     gttcataaat acatttatag gctgggcacg gtggctcacg gttgtaatcc caacactttg      5100
     agaggccaag gcaggtggat catttgagat caggggctca agaccaccct ggccaacatg      5160
     gggaaaatcc atctgtacta aaaatacaaa ataataatta taatgataat aattagccga      5220
     gcatggtggc acatgcctgt agtcccagct acttggtagg gttgggcagg agttgcactt      5280
     aattgcagga ggcggaggtt gcagtgagct gagatcatgc cactgcactg cagcctgggc      5340
     aacagagaga gacactctct caaaattaat taattaatta attagtattc tttttttttt      5400
     accctccacc cttcccttcc tggcctctgg tagccaccat tctactctct acctttgtga      5460
     gatccacctt ttagctcctg catatgagtg agaaatggaa atacttgtaa tgacctccag      5520
     ttccattcat gtggctgtaa atgacaggat gttactcttt ctatggatga gttgtcccta      5580
     ttgtgtgtgt gtaccacatt ctctccatcc attcacccac tgatgggcag gtaggttgat      5640
     ccacatcttg gctactgtga acactgctgg aacagtcatg ggagtgcaga tgtcacttcg      5700
     atacgctgat gtcctttcct ttgggtttac acccagtcat ggaattgcta gatcctctgg      5760
     aagtgtcttt ttacattttg ttttatggtt tttgtttttg tttttgtttt ttttagacag      5820
     tttcactctt gttgcccagg ctggagtgca gtggcgccat ctgggctcac tgcaacctcc      5880
     acctccagga ttcaagagat tccccagcct cagcctccca agtagctggg ttactggctc      5940
     ccaccaccac actcggctaa tttttatatt tttagtagag acagagtttc gctatattgg      6000
     ccaggctgct cttcaactcc tgacctcaag tgacctaccc acctcggcct cccaatgtgc      6060
     tgggattaca ggcatgaacc actgtgcccg acctcatttt attttttgag gaacttccat      6120
     actcttctcc tctgtaatgg ctgtactaat ttacattcgt atcagcagtg taccagatgc      6180
     aaccctggtt gactcagcag agcaagagac gtgcagtaag agagaattta gcttatttat      6240
     gcacacgaca cttccactca ctcactcgtt cagccaatgc cccatgctct ggctgtgcag      6300
     tgtggaatct tttcctattg ttgccataac aaatttccac aagcttcgtg gatgaaaacg      6360
     tgtttttctt aattatctca cagtgctgta actcagaagt atgaactgca tttcactggg      6420
     ctgatatcaa agggagagta aggctggatt tctttttaag gttccaagca agaatctgct      6480
     ccttaacgtt tcccagctcc tagaggctcc cacgttcctg ggctcctggt ccccttcctc      6540
     cttcctcctt cctcaaagcc cacaaaggct ggtcacgtct cacatggcat cattcagaat      6600
     cttcttcttt acccacacct ttttctctga atcctgctct gccttcttcc tcatctttta      6660
     aggactttgg gattctattg gggtcaccaa gataatccat ctcaatctcc ctaaaatcat      6720
     ccagcgtacc ctctttttaa gttcagctga ttagcaaccg taatgccatc tgcaatcttc      6780
     attcctcctt tcctgtaaaa taacatattc acaagctatg gaggctaaga cagggacatt      6840
     ttgggggtgg ggcagcattc tcctgccttc cacaaatggt aaacaggatg catttggcct      6900
     ctgctcttgg gacgctgata ttgcagatgg gtaaatgcga gggcagagaa tgaatgcaca      6960
     agggtaccaa taaatgaatg atccattggg aagcatctgt gcaccaaatc tggggttttt      7020
     tgtgtgtgtg tgtttttttt gttttctttt tttttttgag tagagtctct ctctgttcca      7080
     caggctggag tgcagtagca caatctcagc tcattgcaac ctctgcctcc tgggttcatg      7140
     caattctcct gcctcagcct accgagtagc tgggattaca gctgtgcgcc accacactcg      7200
     gctaattttt ttggtatatt ttttagtaga aatgaggttt caccatgttg tgcaggctgt      7260
     ctcaaactcc caatctcaag tgatcccacc gccttagcgt ccctaagtgc aaagattaca      7320
     ggcgagagct actgcgccca gccaggattt aaaataagta atagataatg ctgagtatac      7380
     aatttcaggt gacagagaag gtctcactga tcagataata tttgtgacct taatggaaaa      7440
     aatggattca acccttggaa gattggcgga aggattttcc acactgagct ctcagccgtg      7500
     aaggcacaaa ggtggaaaca ttcttagttc aaggaagagg ctctgcctca aatgctggga      7560
     atgagatggg gagaatgaca agacgactgt ggagagacgg agagtacact gggtacacag      7620
     gaaactaagg aggaacaagg agcgtgtgtt tgacactcac agcccttgga ttcaactcag      7680
     agctaactag gaatccctac ctgattaaca gtgaccgaca tgaaaataag ggaggcccag      7740
     gtgcgtaact ggaatctagg agaccgtgga aaaggcaatt cccgccccac tggtgaaacg      7800
     tagggttgat ttacacacta aatgaatgaa agatggatat aagctatgct tgtgaggtag      7860
     aatcatttgc agggagggct tgctgggttt gatttttcct agtagtttaa tccttgtttc      7920
     attaatttct ttctgagatg tgtttttttt ctacatctaa atcaatacct ggcagaggag      7980
     cgatagacac atgaggggtg gtgcaaatga agggacctag tataatataa tatacaagac      8040
     tgtggatggg ggctcacacc tgtaacccaa cactttggga ggccaaggcg ggtagatcac      8100
     ttaagggtag gagtttgaga ccagcctggc caacatggtg aaaccccgtc tgtactaaaa      8160
     atacaaaaat tagcctggtg cattggcacc tgcctgtaat cccagcgact ggggaggctg      8220
     aagcagaaga atggcttcaa ccctggaggc agaggttgaa ctgagatcgc atcactgcac      8280
     tccagcctga cacaggggga ctctgtctca aaaaataaaa ataaaacata cataattatg      8340
     acacacagaa attacaaagg caactggata ccaaccatca tttttctatt tctctgtgtt      8400
     taattctttg accctttatc ttatccatta aacaatcagg ttaaacctct tccttatttg      8460
     gctttctgtg agcttgggat catatggaaa atgtgaaagc ctcctgaacc caccagcaca      8520
     ggtcctggaa tagagaacgt gctctgttca tggcataaaa cttgcccctt cacccaaatc      8580
     ccccaattca tctctacttc caatcaccta tggagataca gatagatcat ggggaggtaa      8640
     acactaatac tctttggagt gagctcagat cttggactca gagaccagtg ccagcactag      8700
     cccctggtca catttcgtac taactcacag aaggacaggc tgtattgaaa caataaacga      8760
     cggagagggc ggtccttccc cgtgcttctc gggtggaata gcagcctaat atatgtctca      8820
     gcagatcaca aaaagtagca tgttgttcct gggctacatc attatttcat ggctgtttga      8880
     tttaagtcag ttctacttca ctttttttat cttgatttca ttttttcttt cttttcttgg      8940
     agaatgtaat tttttttgag tcaagagggt tgtggtggta gaaactgtaa agcacattcg      9000
     ctgtgtatca atcccaatcc agtcttccca gagaagattc taaacacctc ctggaatgca      9060
     cctgggccta taccaattcc tatcactcac cgtcactcca gggagacaga acacacagag      9120
     aacacattac acaggcaggt tcattactaa cagataagca gcgagtgaca acagaaacct      9180
     acatttcaat gtgagccagt ccctcaaggc tcagaaaagc tgctcgagac atgtggagtc      9240
     accccatatg cagtgtatct gggggaaatc aaaaagcagc ccagcctggg ttttgtaccc      9300
     tggagccaca ggaagcactc agctaaagca ctgcatgacg tcctcctcca ggaagaacag      9360
     gaagacagcc caggctgttc tgggatgttc ctcctgatct caggacgttg ctgtcttagt      9420
     ccatttttgt tgctctaaag gaacacttga gcctgggtaa cttctaaaga aaagaaatgt      9480
     gtttgcctca cagttctgca ggctgtactg gaagcatggc accagcatct atttcttgtg      9540
     acggcctcag gctgctccca ctctggcaga agggaaggag ggtctgtctg tgcagagacc      9600
     acagagatca cacggcaaga gagggaccaa gggggagggg gagcgatgga gcttccaagc      9660
     tcttttaaca accagttctc caggaactaa tagaggggga acttgctaac cccgtctcct      9720
     tggaacagca ttgatctgtt catgatggat ccacctccat gacccaaaca actcccaaga      9780
     ggcccaacct cccaccctgg gggttacatt tcaatgtgag gtttgaaggg gtcaaacatc      9840
     taaactaaag cagttgtatc ctcagcacgt tctatggtta ctacaactga gaaagcagga      9900
     ggaagctagg tctcccgcca tctgggtgct tgtcctaaag agacgttgta tgtggttacc      9960
     tgtcaatcaa gaaatgtgag acaattcata tagaggaact gctatgatta gcttcttatt     10020
     ggtgtcttgt cttcctccag gtaactccag acacctgcac gttctgattg ggacctcagt     10080
     ggtcatcatc ccctttgcta tcctcctctt ctttctcctt catcgctggt gtgccaacaa     10140
     aaagagtaac tccagacacc tgcacgttct gattgggacc tcagtggtca tcatcccctt     10200
     tgctatcctc ctcttctttc tccttcatcg ctggtgtgcc aacaaaaaga atgctgttgt     10260
     aatggaccaa gagcctgcag ggaacagaac agtgaacagg gagatgctgt tgtaatggac     10320
     caagagcctg cagggaacag aacagtgaac agggaggact ctgatgaaca agaccctcag     10380
     gaggtgacat acgcacagtt gaatcactgc gttttcacac agagaaaaat cactcgccct     10440
     tctcagaggc ccaagacacc cccaacagat accagcgtgt aagactctga tgaacaagac     10500
     cctcaggagg tgacatacgc acagttgaat cactgcgttt tcacacagag aaaaatcact     10560
     cgcccttctc agaggcccaa gacaccccca acagatacca gcgtgtaa                  10608
//